StarFunc result for job id Q9BRZ2

User Input

>input (755 residues)
MVSHGSSPSLLEALSSDFLACKICLEQLRAPKTLPCLHTYCQDCLAQLADGGRVRCPECR
ETVPVPPEGVASFKTNFFVNGLLDLVKARACGDLRAGKPACALCPLVGGTSTGGPATARC
LDCADDLCQACADGHRCTRQTHTHRVVDLVGYRAGWYDEEARERQAAQCPQHPGEALRFL
CQPCSQLLCRECRLDPHLDHPCLPLAEAVRARRPGLEGLLAGVDNNLVELEAARRVEKEA
LARLREQAARVGTQVEEAAEGVLRALLAQKQEVLGQLRAHVEAAEEAARERLAELEGREQ
VARAAAAFARRVLSLGREAEILSLEGAIAQRLRQLQGCPWAPGPAPCLLPQLELHPGLLD
KNCHLLRLSFEEQQPQKDGGKDGAGTQGGEESQSRREDEPKTERQGGVQPQAGDGAQTPK
EEKAQTTREEGAQTLEEDRAQTPHEDGGPQPHRGGRPNKKKKFKGRLKSISREPSPALGP
NLDGSGLLPRPIFYCSFPTRMPGDKRSPRITGLCPFGPREILVADEQNRALKRFSLNGDY
KGTVPVPEGCSPCSVAALQSAVAFSASARLYLINPNGEVQWRRALSLSQASHAVAALPSG
DRVAVSVAGHVEVYNMEGSLATRFIPGGKASRGLRALVFLTTSPQGHFVGSDWQQNSVVI
CDGLGQVVGEYKGPGLHGCQPGSVSVDKKGYIFLTLREVNKVVILDPKGSLLGDFLTAYH
GLEKPRVTTMVDGRYLVVSLSNGTIHIFRVRSPDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80VI1	0.492	0.505	0.000	734	0.803	0.826	Q80VI1.pdb.gz	TRI56_MOUSE E3 ubiquitin-protein ligase TRIM56 OS=Mus musculus OX=10090 GN=Trim56 PE=1 SV=1
2	AFDB:Q9BRZ2	1.000	1.000	0.000	755	1.000	1.000	Q9BRZ2.pdb.gz	TRI56_HUMAN E3 ubiquitin-protein ligase TRIM56 OS=Homo sapiens OX=9606 GN=TRIM56 PE=1 SV=3
3	AFDB:F1QFW2	0.326	0.331	5.691E-35	744	0.201	0.204	F1QFW2.pdb.gz	F1QFW2_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim2 PE=3 SV=1
4	AFDB:O70277	0.303	0.307	1.355E-33	744	0.201	0.204	O70277.pdb.gz	TRIM3_RAT Tripartite motif-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Trim3 PE=1 SV=1
5	AFDB:D3ZQG6	0.292	0.296	4.269E-33	744	0.205	0.208	D3ZQG6.pdb.gz	TRIM2_RAT Tripartite motif-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Trim2 PE=1 SV=2
6	AFDB:E7F1U3	0.322	0.315	4.960E-31	774	0.204	0.199	E7F1U3.pdb.gz	E7F1U3_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim3a PE=1 SV=1
7	AFDB:E7FAM5	0.299	0.276	6.741E-28	824	0.189	0.174	E7FAM5.pdb.gz	LIN41_DANRE E3 ubiquitin-protein ligase TRIM71 OS=Danio rerio OX=7955 GN=trim71 PE=1 SV=1
8	AFDB:P34611	0.299	0.267	1.102E-27	851	0.170	0.150	P34611.pdb.gz	NCL1_CAEEL B-box type zinc finger protein ncl-1 OS=Caenorhabditis elegans OX=6239 GN=ncl-1 PE=2 SV=1
9	AFDB:Q2Q1W2	0.301	0.265	8.212E-25	868	0.193	0.168	Q2Q1W2.pdb.gz	LIN41_HUMAN E3 ubiquitin-protein ligase TRIM71 OS=Homo sapiens OX=9606 GN=TRIM71 PE=1 SV=1
10	AFDB:Q8MQJ9	0.300	0.222	1.008E-22	1037	0.167	0.122	Q8MQJ9.pdb.gz	BRAT_DROME Brain tumor protein OS=Drosophila melanogaster OX=7227 GN=brat PE=1 SV=2
11	PDB:5o9zL	0.259	0.400	2.923E-12	459	0.041	0.068	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
12	PDB:7jvrB	0.282	0.576	4.780E-12	342	0.044	0.096	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
13	PDB:3dm0A	0.251	0.277	6.635E-12	675	0.057	0.064	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
14	PDB:5a2qg	0.259	0.557	7.401E-12	314	0.060	0.143	5a2qg.pdb.gz	Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
15	PDB:7mq8LS	0.258	0.407	8.256E-12	453	0.053	0.088	7mq8LS.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7zgrD	0.266	0.473	1.426E-11	395	0.037	0.071	7zgrD.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
17	PDB:2h9lA	0.266	0.566	2.208E-11	321	0.052	0.121	2h9lA.pdb.gz
18	PDB:7mq8LO	0.186	0.167	3.065E-11	848	0.052	0.046	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:3zwlD	0.261	0.511	3.611E-11	352	0.046	0.099	3zwlD.pdb.gz
20	PDB:7a5pz	0.268	0.416	3.611E-11	460	0.054	0.089	7a5pz.pdb.gz	Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80VI1	0.0	1165	734	0.808	0.831	TRI56_MOUSE E3 ubiquitin-protein ligase TRIM56 OS=Mus musculus OX=10090 GN=Trim56 PE=1 SV=1
2	Q9BRZ2	0.0	1523	755	1.000	1.000	TRI56_HUMAN E3 ubiquitin-protein ligase TRIM56 OS=Homo sapiens OX=9606 GN=TRIM56 PE=1 SV=3
3	F1QFW2	2.53e-33	139	744	0.113	0.114	F1QFW2_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim2 PE=3 SV=1
4	Q58ER5	5.49e-33	138	744	0.113	0.114	Q58ER5_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=zgc:113099 PE=2 SV=1
5	Q9H8W5	4.25e-26	115	580	0.121	0.157	TRI45_HUMAN E3 ubiquitin-protein ligase TRIM45 OS=Homo sapiens OX=9606 GN=TRIM45 PE=1 SV=2
6	M9PH32	8.03e-26	116	1206	0.123	0.077	M9PH32_DROME Meiotic P26, isoform C OS=Drosophila melanogaster OX=7227 GN=mei-P26 PE=1 SV=1
7	Q9Y111	8.16e-26	116	1189	0.123	0.078	Q9Y111_DROME BcDNA.GH10646 OS=Drosophila melanogaster OX=7227 GN=mei-P26 PE=2 SV=1
8	Q6PFY8	8.30e-26	115	580	0.128	0.167	TRI45_MOUSE E3 ubiquitin-protein ligase TRIM45 OS=Mus musculus OX=10090 GN=Trim45 PE=2 SV=2
9	Q9W378	8.30e-26	116	1189	0.123	0.078	Q9W378_DROME FI01101p OS=Drosophila melanogaster OX=7227 GN=mei-P26 PE=2 SV=1
10	D3ZQG6	1.00e-20	99.8	744	0.111	0.113	TRIM2_RAT Tripartite motif-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Trim2 PE=1 SV=2
11	Q9C040	1.05e-20	99.8	744	0.109	0.110	TRIM2_HUMAN Tripartite motif-containing protein 2 OS=Homo sapiens OX=9606 GN=TRIM2 PE=1 SV=1
12	Q9ESN6	1.19e-20	99.4	744	0.111	0.113	TRIM2_MOUSE Tripartite motif-containing protein 2 OS=Mus musculus OX=10090 GN=Trim2 PE=1 SV=1
13	Q9UPN9	2.96e-19	95.5	1127	0.114	0.076	TRI33_HUMAN E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33 PE=1 SV=3
14	E7FAM5	7.00e-19	94.0	824	0.122	0.112	LIN41_DANRE E3 ubiquitin-protein ligase TRIM71 OS=Danio rerio OX=7955 GN=trim71 PE=1 SV=1
15	Q99PP7	8.66e-19	94.0	1142	0.109	0.072	TRI33_MOUSE E3 ubiquitin-protein ligase TRIM33 OS=Mus musculus OX=10090 GN=Trim33 PE=1 SV=2
16	Q13263	5.57e-18	91.3	835	0.089	0.080	TIF1B_HUMAN Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5
17	E7F1U3	1.26e-17	90.1	774	0.106	0.103	E7F1U3_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim3a PE=1 SV=1
18	Q62318	2.56e-17	89.0	834	0.086	0.078	TIF1B_MOUSE Transcription intermediary factor 1-beta OS=Mus musculus OX=10090 GN=Trim28 PE=1 SV=3
19	O08629	2.63e-17	89.0	835	0.086	0.078	TIF1B_RAT Transcription intermediary factor 1-beta OS=Rattus norvegicus OX=10116 GN=Trim28 PE=1 SV=2
20	O70277	5.40e-17	87.8	744	0.122	0.124	TRIM3_RAT Tripartite motif-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Trim3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00649 Copper-fist	8.2e+02	10.9	Copper fist DNA binding domain
2	PF13449 Phytase-like	4.5e+02	12.2	Esterase-like activity of phytase
3	PF14447 Prok-RING_4	38	15.6	Prokaryotic RING finger family 4
4	PF00643 zf-B_box	5.3e-05	34.6	B-box zinc finger
5	PF00097 zf-C3HC4	0.0001	33.4	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	0.00065	30.8	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	0.0011	30.1	Zinc finger, C3HC4 type (RING finger)
8	PF15227 zf-C3HC4_4	0.69	21.4	zinc finger of C3HC4-type, RING
9	PF13639 zf-RING_2	0.024	26.3	Ring finger domain
10	PF14634 zf-RING_5	0.0028	28.9	zinc-RING finger domain
11	PF13445 zf-RING_UBOX	2.1e-06	39.0	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305161

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000408292	0.970	E3 ubiquitin-protein ligase TRIM32
2	9606.ENSP00000304697	0.909	Polyubiquitin-B
3	9606.ENSP00000272317	0.907	Ubiquitin-40S ribosomal protein S27a
4	9606.ENSP00000441543	0.904	Polyubiquitin-C
5	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
6	9606.ENSP00000331288	0.847	Stimulator of interferon genes protein
7	9606.ENSP00000329967	0.748	Serine/threonine-protein kinase TBK1
8	9606.ENSP00000220592	0.740	Protein argonaute-2
9	9606.ENSP00000395086	0.740	Tripartite motif-containing 51
10	9606.ENSP00000362300	0.739	Protein argonaute-1
11	9606.ENSP00000362306	0.739	Protein argonaute-4
12	9606.ENSP00000161863	0.726	Probable ATP-dependent RNA helicase YTHDC2
13	9606.ENSP00000349596	0.715	E3 ubiquitin-protein ligase TRIM38
14	9606.ENSP00000295756	0.681	T-cell receptor-associated transmembrane adapter 1
15	9606.ENSP00000359339	0.678	Cyclic GMP-AMP synthase
16	9606.ENSP00000369373	0.667	Tripartite motif-containing protein 5
17	9606.ENSP00000254436	0.654	E3 ubiquitin-protein ligase TRIM21
18	9606.ENSP00000364235	0.638	E3 ubiquitin-protein ligase RNF5
19	9606.ENSP00000405111	0.637	Putative ATP-dependent RNA helicase DHX57
20	9606.ENSP00000263182	0.634	Gamma-butyrobetaine dioxygenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0003723	0.997	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0010468	0.995	regulation of gene expression
GO:0048518	0.994	positive regulation of biological process
GO:0044238	0.993	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0050896	0.990	response to stimulus
GO:0043170	0.986	macromolecule metabolic process
GO:0045088	0.986	regulation of innate immune response
GO:0001817	0.985	regulation of cytokine production
GO:0032479	0.983	regulation of type I interferon production
GO:0001959	0.982	regulation of cytokine-mediated signaling pathway
GO:0048584	0.977	positive regulation of response to stimulus
GO:0009615	0.977	response to virus
GO:0140546	0.975	defense response to symbiont
GO:0036211	0.967	protein modification process
GO:0048522	0.963	positive regulation of cellular process
GO:0016567	0.961	protein ubiquitination
GO:0060338	0.959	regulation of type I interferon-mediated signaling pathway
GO:0045089	0.955	positive regulation of innate immune response
GO:0051607	0.937	defense response to virus
GO:0023056	0.913	positive regulation of signaling
GO:0009967	0.900	positive regulation of signal transduction
GO:0060760	0.873	positive regulation of response to cytokine stimulus
GO:0009987	0.842	cellular process
GO:0001961	0.762	positive regulation of cytokine-mediated signaling pathway
GO:0006513	0.724	protein monoubiquitination
GO:0048519	0.659	negative regulation of biological process
GO:0009893	0.536	positive regulation of metabolic process
GO:0010604	0.523	positive regulation of macromolecule metabolic process
GO:0002376	0.444	immune system process
GO:0045087	0.398	innate immune response
GO:0044237	0.350	cellular metabolic process
GO:0031323	0.327	regulation of cellular metabolic process
GO:0080090	0.303	regulation of primary metabolic process
GO:0051171	0.303	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.749	organelle
GO:0043227	0.728	membrane-bounded organelle
GO:0043231	0.719	intracellular membrane-bounded organelle
GO:0005634	0.703	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]