StarFunc result for job id Q9BS16

User Input

>input (269 residues)
MNQEDLDPDSTTDVGDVTNTEEELIRECEEMWKDMEECQNKLSLIGTETLTDSNAQLSLL
IMQVKCLTAELSQWQKKTPETIPLTEDVLITLGKEEFQKLRQDLEMVLSTKESKNEKLKE
DLEREQRWLDEQQQIMESLNVLHSELKNKVETFSESRIFNELKTKMLNIKEYKEKLLSTL
GEFLEDHFPLPDRSVKKKKKNIQESSVNLITLHEMLEILINRLFDVPHDPYVKISDSFWP
PYVELLLRNGIALRHPEDPTRIRLEAFHQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BS16	1.000	1.000	2.847E-40	269	1.000	1.000	Q9BS16.pdb.gz	CENPK_HUMAN Centromere protein K OS=Homo sapiens OX=9606 GN=CENPK PE=1 SV=1
2	AFDB:Q9ESN5	0.645	0.641	9.347E-32	271	0.751	0.745	Q9ESN5.pdb.gz	CENPK_MOUSE Centromere protein K OS=Mus musculus OX=10090 GN=Cenpk PE=1 SV=2
3	PDB:7qooK	0.364	0.384	3.139E-31	253	0.937	0.996	7qooK.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
4	PDB:7yyhK	0.318	0.391	1.004E-27	217	0.803	0.995	7yyhK.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
5	AFDB:O94494	0.309	0.301	9.929E-5	277	0.160	0.155	O94494.pdb.gz	CENPK_SCHPO Inner kinetochore subunit sim4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sim4 PE=1 SV=1
6	PDB:6v9iC	0.121	0.052	2.628E-1	730	0.033	0.012	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
7	PDB:6wucK	0.215	0.240	3.669E-1	235	0.156	0.179	6wucK.pdb.gz
8	PDB:6wgeC	0.155	0.222	1.219	174	0.052	0.080	6wgeC.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
9	PDB:2xv4S	0.105	0.075	1.303	399	0.030	0.020	2xv4S.pdb.gz
10	PDB:6uxwA	0.231	0.090	1.393	778	0.171	0.059	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
11	PDB:4zzlA	0.112	0.192	1.591	146	0.045	0.082	4zzlA.pdb.gz
12	AFDB:O14014	0.156	0.053	1.683	969	0.119	0.033	O14014.pdb.gz	RGA3_SCHPO Probable Rho-type GTPase-activating protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga3 PE=1 SV=1
13	AFDB:Q8NEE6	0.221	0.107	1.799	735	0.115	0.042	Q8NEE6.pdb.gz	FXL13_HUMAN F-box and leucine-rich repeat protein 13 OS=Homo sapiens OX=9606 GN=FBXL13 PE=2 SV=3
14	AFDB:O95229	0.264	0.258	2.349	277	0.156	0.152	O95229.pdb.gz	ZWINT_HUMAN ZW10 interactor OS=Homo sapiens OX=9606 GN=ZWINT PE=1 SV=2
15	AFDB:Q96HY6	0.159	0.138	2.349	314	0.138	0.118	Q96HY6.pdb.gz	DDRGK_HUMAN DDRGK domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DDRGK1 PE=1 SV=2
16	PDB:1jhfA	0.174	0.230	2.375	197	0.030	0.041	1jhfA.pdb.gz
17	PDB:7r5jV0	0.135	0.134	2.375	273	0.164	0.161	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
18	AFDB:A0A1B0GVV3	0.318	0.230	3.279	386	0.138	0.096	A0A1B0GVV3.pdb.gz	A0A1B0GVV3_HUMAN Rab interacting lysosomal protein like 1 OS=Homo sapiens OX=9606 GN=RILPL1 PE=1 SV=1
19	AFDB:Q4WQC6	0.174	0.107	3.279	499	0.178	0.096	Q4WQC6.pdb.gz	Q4WQC6_ASPFU Myosin heavy chain OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G12350 PE=4 SV=1
20	AFDB:Q9C075	0.263	0.179	4.005	422	0.167	0.107	Q9C075.pdb.gz	K1C23_HUMAN Keratin, type I cytoskeletal 23 OS=Homo sapiens OX=9606 GN=KRT23 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BS16	0.0	541	269	1.000	1.000	CENPK_HUMAN Centromere protein K OS=Homo sapiens OX=9606 GN=CENPK PE=1 SV=1
2	Q9ESN5	3.59e-141	399	271	0.751	0.745	CENPK_MOUSE Centromere protein K OS=Mus musculus OX=10090 GN=Cenpk PE=1 SV=2
3	Q16543	1.5	32.3	378	0.149	0.106	CDC37_HUMAN Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1
4	A1YB07	2.3	32.3	721	0.074	0.028	AMOL2_DANRE Angiomotin-like 2a OS=Danio rerio OX=7955 GN=amotl2a PE=1 SV=2
5	A8J0N6	2.3	32.0	356	0.134	0.101	DRC10_CHLRE Dynein regulatory complex protein 10 OS=Chlamydomonas reinhardtii OX=3055 GN=DRC10 PE=1 SV=1
6	O88572	3.1	32.0	1613	0.052	0.009	LRP6_MOUSE Low-density lipoprotein receptor-related protein 6 OS=Mus musculus OX=10090 GN=Lrp6 PE=1 SV=1
7	A0A0G2K0H3	3.3	31.6	1613	0.052	0.009	A0A0G2K0H3_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp6 PE=3 SV=1
8	O75581	3.6	31.6	1613	0.052	0.009	LRP6_HUMAN Low-density lipoprotein receptor-related protein 6 OS=Homo sapiens OX=9606 GN=LRP6 PE=1 SV=2
9	P36086	4.3	30.8	256	0.078	0.082	YKH1_YEAST Uncharacterized oxidoreductase YKL071W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YKL071W PE=1 SV=1
10	P54697	6.3	30.8	2245	0.074	0.009	MYOJ_DICDI Myosin-J heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoJ PE=3 SV=2
11	Q9LHB1	8.1	30.4	638	0.156	0.066	FDM3_ARATH Factor of DNA methylation 3 OS=Arabidopsis thaliana OX=3702 GN=FDM3 PE=4 SV=1
12	D6RUV3	9.1	30.4	1386	0.100	0.019	D6RUV3_DANRE Protein strawberry notch homolog 1 OS=Danio rerio OX=7955 GN=sbno1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00022 Actin	2.2e+02	11.9	Actin
2	PF11802 CENP-K	9e-121	414.0	Centromere-associated protein K
3	PF10828 DUF2570	9.3e+02	11.2	Protein of unknown function (DUF2570)
4	PF14301 DUF4376	1.2e+02	14.5	Domain of unknown function (DUF4376)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379911

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000283006	0.999	Centromere protein H
2	9606.ENSP00000362018	0.996	Centromere protein I
3	9606.ENSP00000370214	0.993	Centromere protein O
4	9606.ENSP00000281453	0.989	Centromere protein U
5	9606.ENSP00000215980	0.988	Centromere protein M
6	9606.ENSP00000337289	0.987	Centromere protein Q
7	9606.ENSP00000360133	0.987	Centromere protein R
8	9606.ENSP00000348527	0.983	Centromere protein L
9	9606.ENSP00000377007	0.982	Centromere protein N
10	9606.ENSP00000457810	0.976	Centromere protein T
11	9606.ENSP00000308583	0.974	Centromere protein S
12	9606.ENSP00000364737	0.964	Centromere protein P
13	9606.ENSP00000273853	0.960	Centromere protein C
14	9606.ENSP00000357308	0.955	Constitutive centromere associated network
15	9606.ENSP00000376168	0.925	Centromere protein X
16	9606.ENSP00000336868	0.916	Histone H3-like centromeric protein A
17	9606.ENSP00000335463	0.914	Kinetochore scaffold 1
18	9606.ENSP00000309790	0.873	Mis18-binding protein 1
19	9606.ENSP00000389810	0.831	Kinetochore-associated protein DSN1 homolog
20	9606.ENSP00000271452	0.818	Kinetochore protein Nuf2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0048522	0.983	positive regulation of cellular process
GO:0051173	0.977	positive regulation of nitrogen compound metabolic process
GO:0010604	0.976	positive regulation of macromolecule metabolic process
GO:0019219	0.976	regulation of nucleobase-containing compound metabolic process
GO:0045935	0.957	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.948	regulation of DNA-templated transcription
GO:1902680	0.926	positive regulation of RNA biosynthetic process
GO:0006357	0.916	regulation of transcription by RNA polymerase II
GO:0045893	0.916	positive regulation of DNA-templated transcription
GO:0045944	0.773	positive regulation of transcription by RNA polymerase II
GO:0009987	0.702	cellular process
GO:0007049	0.538	cell cycle
GO:0016043	0.487	cellular component organization
GO:0006996	0.436	organelle organization
GO:0022402	0.401	cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005829	0.992	cytosol
GO:0043232	0.557	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]