StarFunc result for job id Q9BSB4

User Input

>input (218 residues)
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFI
DFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWE
VWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDT
GLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BSB4	1.000	1.000	5.139E-48	218	1.000	1.000	Q9BSB4.pdb.gz	ATGA1_HUMAN Autophagy-related protein 101 OS=Homo sapiens OX=9606 GN=ATG101 PE=1 SV=1
2	PDB:5xv1D	0.905	0.914	9.080E-40	216	0.977	0.986	5xv1D.pdb.gz
3	AFDB:Q9VWQ1	0.892	0.892	1.808E-31	218	0.482	0.482	Q9VWQ1.pdb.gz	Q9VWQ1_DROME Autophagy-related protein 101 OS=Drosophila melanogaster OX=7227 GN=Atg101 PE=2 SV=1
4	AFDB:Q95XH2	0.818	0.688	8.378E-23	260	0.344	0.288	Q95XH2.pdb.gz	Q95XH2_CAEEL Autophagy-related protein 101 OS=Caenorhabditis elegans OX=6239 GN=epg-9 PE=3 SV=2
5	AFDB:F4K265	0.666	0.675	8.399E-13	215	0.202	0.205	F4K265.pdb.gz	AT101_ARATH Autophagy-related protein 101 OS=Arabidopsis thaliana OX=3702 GN=ATG101 PE=1 SV=1
6	AFDB:Q54J54	0.639	0.739	4.543E-12	186	0.193	0.226	Q54J54.pdb.gz	Q54J54_DICDI Autophagy-related protein 101 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288287 PE=3 SV=1
7	AFDB:O13978	0.618	0.722	9.364E-12	184	0.211	0.250	O13978.pdb.gz	AT101_SCHPO Autophagy-related protein 101 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg101 PE=1 SV=1
8	PDB:4yk8A	0.588	0.774	1.797E-10	162	0.211	0.284	4yk8A.pdb.gz
9	AFDB:B1AK43	0.448	0.488	2.492E-2	197	0.106	0.117	B1AK43.pdb.gz	B1AK43_HUMAN Mitotic arrest deficient 2 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=MAD2L2 PE=1 SV=8
10	AFDB:Q556Y9	0.304	0.323	2.812E-2	203	0.101	0.108	Q556Y9.pdb.gz	MD2L1_DICDI Mitotic spindle assembly checkpoint protein MAD2A OS=Dictyostelium discoideum OX=44689 GN=mad2l1-1 PE=3 SV=1
11	AFDB:P40958	0.335	0.365	6.156E-2	196	0.115	0.128	P40958.pdb.gz	MAD2_YEAST Mitotic spindle checkpoint component MAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAD2 PE=1 SV=1
12	AFDB:Q59VQ3	0.410	0.417	1.059E-1	214	0.124	0.126	Q59VQ3.pdb.gz	MAD2_CANAL Spindle assembly checkpoint component MAD2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MAD2 PE=3 SV=1
13	PDB:7ksoC	0.137	0.086	1.349E-1	420	0.092	0.048	7ksoC.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
14	PDB:2v64A	0.321	0.332	1.616E-1	210	0.128	0.133	2v64A.pdb.gz	The MAD2 Conformational Dimer: Structure and Implications for the Spindle Assembly Checkpoint
15	PDB:6jilB	0.124	0.095	1.823E-1	298	0.083	0.060	6jilB.pdb.gz	Cyclization mechanism catalyzed by an ATP-grasp enzyme essential for d-cycloserine biosynthesis.
16	PDB:2mv2A	0.149	0.191	2.184E-1	148	0.083	0.122	2mv2A.pdb.gz
17	PDB:7b9kA	0.118	0.093	2.320E-1	320	0.101	0.069	7b9kA.pdb.gz
18	PDB:6bi7G	0.315	0.428	2.953E-1	154	0.106	0.149	6bi7G.pdb.gz	Rev7 dimerization is important for assembly and function of the Rev1/Pol zeta translesion synthesis complex.
19	PDB:2xn9C	0.121	0.123	4.240E-1	215	0.073	0.074	2xn9C.pdb.gz	The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation.
20	PDB:4fu0A	0.146	0.096	4.240E-1	343	0.106	0.067	4fu0A.pdb.gz	Structural and functional characterization of VanG D-Ala:D-Ser ligase associated with vancomycin resistance in Enterococcus faecalis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BSB4	3.21e-164	453	218	1.000	1.000	ATGA1_HUMAN Autophagy-related protein 101 OS=Homo sapiens OX=9606 GN=ATG101 PE=1 SV=1
2	Q9D8Z6	4.73e-162	447	218	0.986	0.986	ATGA1_MOUSE Autophagy-related protein 101 OS=Mus musculus OX=10090 GN=Atg101 PE=1 SV=1
3	Q9VWQ1	1.40e-85	254	218	0.509	0.509	Q9VWQ1_DROME Autophagy-related protein 101 OS=Drosophila melanogaster OX=7227 GN=Atg101 PE=2 SV=1
4	Q95XH2	5.62e-38	134	260	0.349	0.292	Q95XH2_CAEEL Autophagy-related protein 101 OS=Caenorhabditis elegans OX=6239 GN=epg-9 PE=3 SV=2
5	H2L0S0	3.24e-21	89.4	214	0.252	0.257	H2L0S0_CAEEL Autophagy-related protein 101 OS=Caenorhabditis elegans OX=6239 GN=epg-9 PE=3 SV=1
6	Q86DD3	6.05e-14	69.7	187	0.142	0.166	Q86DD3_CAEEL Autophagy-related protein 101 OS=Caenorhabditis elegans OX=6239 GN=epg-9 PE=3 SV=1
7	Q54J54	2.21e-09	57.0	186	0.188	0.220	Q54J54_DICDI Autophagy-related protein 101 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288287 PE=3 SV=1
8	F4K265	7.23e-08	53.1	215	0.142	0.144	AT101_ARATH Autophagy-related protein 101 OS=Arabidopsis thaliana OX=3702 GN=ATG101 PE=1 SV=1
9	O13978	5.94e-07	50.1	184	0.193	0.228	AT101_SCHPO Autophagy-related protein 101 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg101 PE=1 SV=1
10	O96296	3.7	31.2	2177	0.087	0.009	O96296_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0223500 PE=4 SV=3
11	O43868	4.5	30.8	658	0.092	0.030	S28A2_HUMAN Sodium/nucleoside cotransporter 2 OS=Homo sapiens OX=9606 GN=SLC28A2 PE=2 SV=2
12	Q8VRM4	9.1	29.3	187	0.083	0.096	Q8VRM4_ECOLX General secretion pathway protein GspJ OS=Escherichia coli OX=562 GN=gspJ PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07855 ATG101	2.2e-37	139.9	Autophagy-related protein 101

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 29073.XP_008702822.1

Rank	PPI partner	STRING score	Description
1	29073.XP_008699241.1	0.998	Belongs to the ATG13 family. Metazoan subfamily.
2	29073.XP_008704903.1	0.997	RB1 inducible coiled-coil 1
3	29073.XP_008706554.1	0.991	Unc-51 like autophagy activating kinase 1
4	29073.XP_008684261.1	0.990	Unc-51 like autophagy activating kinase 2
5	29073.XP_008692956.1	0.964	Belongs to the PI3/PI4-kinase family.
6	29073.XP_008692238.1	0.951	Regulatory associated protein of MTOR complex 1
7	29073.XP_008701726.1	0.950	Beclin 1-associated autophagy-related key regulator
8	29073.XP_008699530.1	0.949	Beclin-1 isoform X1
9	29073.XP_008689623.1	0.947	Phosphatidylinositol 3-kinase catalytic subunit type 3
10	29073.XP_008707017.1	0.941	Phosphoinositide 3-kinase regulatory subunit 4
11	29073.XP_008693312.1	0.936	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns
12	29073.XP_008695311.1	0.930	MTOR associated protein, LST8 homolog
13	29073.XP_008695478.1	0.909	Beclin-2
14	29073.XP_008706701.1	0.866	Unc-51 like kinase 3
15	29073.XP_008692790.1	0.859	Belongs to the protein kinase superfamily.
16	29073.XP_008701643.1	0.859	Serine/threonine-protein kinase 35
17	29073.XP_008699250.1	0.817	Autophagy and beclin 1 regulator 1
18	29073.XP_008684804.1	0.804	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
19	29073.XP_008703191.1	0.735	Forkhead box protein O3
20	29073.XP_008699552.1	0.712	NBR1, autophagy cargo receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0042802	1.000	identical protein binding
GO:0019899	0.903	enzyme binding
GO:0019901	0.405	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.987	cellular metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0016043	0.978	cellular component organization
GO:0031323	0.977	regulation of cellular metabolic process
GO:0071704	0.966	organic substance metabolic process
GO:0070925	0.958	organelle assembly
GO:0031399	0.958	regulation of protein modification process
GO:0016236	0.958	macroautophagy
GO:0044238	0.955	primary metabolic process
GO:0000045	0.949	autophagosome assembly
GO:0046777	0.935	protein autophosphorylation
GO:0048523	0.863	negative regulation of cellular process
GO:0048518	0.836	positive regulation of biological process
GO:0008285	0.821	negative regulation of cell population proliferation
GO:0048522	0.801	positive regulation of cellular process
GO:2000112	0.789	regulation of cellular macromolecule biosynthetic process
GO:0009894	0.628	regulation of catabolic process
GO:0010506	0.610	regulation of autophagy
GO:0009893	0.596	positive regulation of metabolic process
GO:0031325	0.582	positive regulation of cellular metabolic process
GO:0009896	0.492	positive regulation of catabolic process
GO:0010508	0.368	positive regulation of autophagy
GO:0050896	0.331	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000407	1.000	phagophore assembly site
GO:0012505	0.998	endomembrane system
GO:0005829	0.996	cytosol
GO:0016020	0.994	membrane
GO:0032991	0.993	protein-containing complex
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0031090	0.960	organelle membrane
GO:1990234	0.952	transferase complex
GO:0061695	0.914	transferase complex, transferring phosphorus-containing groups
GO:0031984	0.743	organelle subcompartment
GO:0042175	0.735	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.731	endoplasmic reticulum membrane
GO:1902911	0.669	protein kinase complex
GO:1902554	0.664	serine/threonine protein kinase complex
GO:1990316	0.546	Atg1/ULK1 kinase complex
GO:0098588	0.362	bounding membrane of organelle
GO:0031981	0.338	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]