StarFunc result for job id Q9BSE4

User Input

>input (406 residues)
MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSG
RLLPDHLQLKDILRKQDEYHMVHLVCTSRTPPSSPKSSTNRESHEALASSSNSSSDHSGS
TTPSSGQETLSLAVGSSSEGLRQRTLPQAQTDQAQSHQFPYVMQGNVDNQFPGQAAPPGF
PVYPAFSPLQMLWWQQMYAHQYYMQYQAAVSAQATSNVNPTQPTTSQPLNLAHVPGEEPP
PAPNLVAQENRPMNENVQMNAQGGPVLNEEDFNRDWLDWMYTFSRAAILLSIVYFYSSFS
RFIMVMGAMLLVYLHQAGWFPFRQEGGHQQAPNNNAEVNNDGQNANNLELEEMERLMDDG
LEDESGEDGGEDASAIQRPGLMASAWSFITTFFTSLIPEGPPQVAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BSE4	1.000	1.000	2.320E-69	406	1.000	1.000	Q9BSE4.pdb.gz	HERP2_HUMAN Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein OS=Homo sapiens OX=9606 GN=HERPUD2 PE=1 SV=2
2	AFDB:Q9JJC9	0.241	0.242	1.687E-58	404	0.894	0.899	Q9JJC9.pdb.gz	HERP2_MOUSE Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein OS=Mus musculus OX=10090 GN=Herpud2 PE=2 SV=1
3	AFDB:Q15011	0.229	0.237	1.968E-29	391	0.382	0.396	Q15011.pdb.gz	HERP1_HUMAN Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein OS=Homo sapiens OX=9606 GN=HERPUD1 PE=1 SV=1
4	AFDB:Q9ESS9	0.228	0.237	2.387E-29	391	0.401	0.417	Q9ESS9.pdb.gz
5	AFDB:Q9VLW9	0.209	0.183	2.105E-18	465	0.303	0.265	Q9VLW9.pdb.gz	Q9VLW9_DROME Homocysteine-induced endoplasmic reticulum protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Herp PE=1 SV=1
6	AFDB:Q9NRR5	0.214	0.151	7.955E-9	601	0.153	0.103	Q9NRR5.pdb.gz	UBQL4_HUMAN Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4 PE=1 SV=2
7	AFDB:Q84L30	0.179	0.192	4.871E-7	378	0.158	0.169	Q84L30.pdb.gz	RD23D_ARATH Ubiquitin receptor RAD23d OS=Arabidopsis thaliana OX=3702 GN=RAD23D PE=1 SV=2
8	PDB:7rbsB	0.184	0.455	1.973E-6	157	0.044	0.115	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
9	PDB:3ai5A	0.168	0.226	2.551E-6	299	0.039	0.054	3ai5A.pdb.gz
10	PDB:3dbhI	0.185	0.773	4.002E-6	86	0.047	0.221	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
11	PDB:6yvaC	0.182	0.458	6.693E-6	155	0.047	0.123	6yvaC.pdb.gz
12	PDB:6mdhA	0.174	0.455	8.117E-6	149	0.030	0.081	6mdhA.pdb.gz
13	PDB:4pyuA	0.173	0.835	1.050E-5	76	0.032	0.171	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
14	PDB:3plvA	0.167	0.752	1.119E-5	80	0.034	0.175	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
15	PDB:4x57B	0.174	0.680	1.194E-5	93	0.034	0.151	4x57B.pdb.gz
16	PDB:5k1aF	0.176	0.122	3.561E-5	600	0.032	0.022	5k1aF.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
17	PDB:1qzeA	0.163	0.294	4.319E-5	214	0.042	0.079	1qzeA.pdb.gz
18	AFDB:Q9V3W9	0.183	0.180	4.678E-5	414	0.150	0.147	Q9V3W9.pdb.gz	Q9V3W9_DROME UV excision repair protein RAD23 OS=Drosophila melanogaster OX=7227 GN=Rad23 PE=1 SV=1
19	AFDB:E1ANH4	0.170	0.088	1.242E-3	863	0.192	0.090	E1ANH4.pdb.gz
20	AFDB:H2L0S5	0.147	0.077	4.792E-3	836	0.116	0.056	H2L0S5.pdb.gz	H2L0S5_CAEEL Actin interacting protein 3-like C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y71H2AM.15 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BSE4	0.0	842	406	1.000	1.000	HERP2_HUMAN Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein OS=Homo sapiens OX=9606 GN=HERPUD2 PE=1 SV=2
2	Q9JJC9	0.0	705	404	0.894	0.899	HERP2_MOUSE Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein OS=Mus musculus OX=10090 GN=Herpud2 PE=2 SV=1
3	Q9JJK5	2.27e-84	264	391	0.409	0.425	HERP1_MOUSE Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein OS=Mus musculus OX=10090 GN=Herpud1 PE=1 SV=1
4	Q15011	8.44e-84	263	391	0.409	0.425	HERP1_HUMAN Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein OS=Homo sapiens OX=9606 GN=HERPUD1 PE=1 SV=1
5	A0A8I6B3C5	6.55e-82	261	489	0.409	0.339	A0A8I6B3C5_RAT Homocysteine inducible ER protein with ubiquitin like domain 1 OS=Rattus norvegicus OX=10116 GN=Herpud1 PE=1 SV=1
6	F7F5G8	2.20e-65	214	354	0.357	0.410	F7F5G8_RAT Homocysteine inducible ER protein with ubiquitin like domain 1 OS=Rattus norvegicus OX=10116 GN=Herpud1 PE=1 SV=1
7	Q9VLW9	3.71e-18	88.2	465	0.103	0.090	Q9VLW9_DROME Homocysteine-induced endoplasmic reticulum protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Herp PE=1 SV=1
8	Q8SZY6	2.11e-04	45.1	258	0.049	0.078	Q8SZY6_DROME LD48048p OS=Drosophila melanogaster OX=7227 GN=Herp PE=2 SV=1
9	Q10169	0.032	38.5	354	0.071	0.082	DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph1 PE=4 SV=1
10	A2QB71	0.043	38.5	619	0.049	0.032	A2QB71_ASPNC Contig An01c0450, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An01g14100 PE=4 SV=1
11	Q9NIF3	0.14	37.0	523	0.042	0.033	UBQL_DICDI Ubiquilin OS=Dictyostelium discoideum OX=44689 GN=ubqln PE=1 SV=1
12	Q96JG9	0.17	37.0	3925	0.052	0.005	ZN469_HUMAN Zinc finger protein 469 OS=Homo sapiens OX=9606 GN=ZNF469 PE=2 SV=3
13	Q9SII9	0.27	35.8	538	0.096	0.072	DSK2A_ARATH Ubiquitin domain-containing protein DSK2a OS=Arabidopsis thaliana OX=3702 GN=DSK2A PE=1 SV=2
14	Q7G192	1.9	33.5	1321	0.044	0.014	ALDO2_ARATH Indole-3-acetaldehyde oxidase OS=Arabidopsis thaliana OX=3702 GN=AAO2 PE=1 SV=2
15	Q6MG49	2.5	33.1	1146	0.076	0.027	BAG6_RAT Large proline-rich protein BAG6 OS=Rattus norvegicus OX=10116 GN=Bag6 PE=1 SV=2
16	P54727	2.8	32.7	409	0.042	0.042	RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1
17	A0A1D8PGE3	4.7	32.0	416	0.076	0.075	A0A1D8PGE3_CANAL UV excision repair protein RAD23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD23 PE=3 SV=1
18	Q9Z1R2	4.9	32.0	1154	0.081	0.029	BAG6_MOUSE Large proline-rich protein BAG6 OS=Mus musculus OX=10090 GN=Bag6 PE=1 SV=1
19	G1SU30	6.0	31.6	1162	0.081	0.028	G1SU30_RABIT Large proline-rich protein BAG6 OS=Oryctolagus cuniculus OX=9986 GN=BAG6 PE=4 SV=2
20	O74803	6.6	31.2	368	0.037	0.041	RHP23_SCHPO UV excision repair protein rhp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp23 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10302 Dsc3_N	19	17.2	DSC E3 ubiquitin ligase complex subunit 3, ubiquitin-like domain
2	PF13881 Rad60-SLD_2	6.4e+02	11.9	Ubiquitin-2 like Rad60 SUMO-like
3	PF00240 ubiquitin	0.00022	32.2	Ubiquitin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379390

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366395	0.709	E3 ubiquitin-protein ligase synoviolin
2	9606.ENSP00000327525	0.601	Olfactory receptor 4F6
3	9606.ENSP00000256497	0.597	ER degradation-enhancing alpha-mannosidase-like protein 1
4	9606.ENSP00000368798	0.558	Membrane-bound transcription factor site-2 protease
5	9606.ENSP00000392330	0.548	B-cell receptor-associated protein 31
6	9606.ENSP00000330247	0.523	5'-nucleotidase domain containing 4
7	9606.ENSP00000337053	0.513	Protein sel-1 homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.975	organic substance metabolic process
GO:0050896	0.974	response to stimulus
GO:0009987	0.974	cellular process
GO:0044238	0.974	primary metabolic process
GO:0051716	0.956	cellular response to stimulus
GO:0065007	0.950	biological regulation
GO:0050794	0.943	regulation of cellular process
GO:0006807	0.904	nitrogen compound metabolic process
GO:0034976	0.893	response to endoplasmic reticulum stress
GO:0044237	0.851	cellular metabolic process
GO:0019538	0.821	protein metabolic process
GO:0042221	0.756	response to chemical
GO:0048583	0.755	regulation of response to stimulus
GO:0019222	0.745	regulation of metabolic process
GO:0010033	0.718	response to organic substance
GO:0060255	0.716	regulation of macromolecule metabolic process
GO:0051171	0.705	regulation of nitrogen compound metabolic process
GO:0080090	0.704	regulation of primary metabolic process
GO:0006508	0.686	proteolysis
GO:0051246	0.605	regulation of protein metabolic process
GO:0051179	0.582	localization
GO:0009056	0.566	catabolic process
GO:0006810	0.538	transport
GO:0051641	0.525	cellular localization
GO:1901575	0.514	organic substance catabolic process
GO:0033036	0.497	macromolecule localization
GO:0048519	0.475	negative regulation of biological process
GO:0048523	0.463	negative regulation of cellular process
GO:0051603	0.440	proteolysis involved in protein catabolic process
GO:0031323	0.424	regulation of cellular metabolic process
GO:0044260	0.417	cellular macromolecule metabolic process
GO:0048518	0.404	positive regulation of biological process
GO:0032501	0.377	multicellular organismal process
GO:0032502	0.357	developmental process
GO:0048522	0.351	positive regulation of cellular process
GO:0008104	0.335	protein localization
GO:0019941	0.326	modification-dependent protein catabolic process
GO:0006511	0.324	ubiquitin-dependent protein catabolic process
GO:0035966	0.301	response to topologically incorrect protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane
GO:0032991	0.538	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]