StarFunc result for job id Q9BSE5

User Input

>input (352 residues)
MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMM
RLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLGTVNPSTGALPFQSLM
VADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVG
LLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQ
GFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQ
ALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BSE5	1.000	1.000	9.103E-78	352	1.000	1.000	Q9BSE5.pdb.gz	GDAH_HUMAN Guanidino acid hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=AGMAT PE=1 SV=2
2	AFDB:Q9I3S3	0.885	0.976	4.958E-54	319	0.551	0.608	Q9I3S3.pdb.gz	GBUA_PSEAE Guanidinobutyrase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=gbuA PE=1 SV=1
3	PDB:3nioA	0.864	0.961	1.699E-47	316	0.545	0.608	3nioA.pdb.gz	Crystal structures of Pseudomonas aeruginosa guanidinobutyrase and guanidinopropionase, members of the ureohydrolase superfamily
4	AFDB:Q10088	0.804	0.722	3.542E-32	394	0.315	0.282	Q10088.pdb.gz	SPEB1_SCHPO Putative agmatinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC11D3.09 PE=3 SV=1
5	AFDB:P60651	0.750	0.860	3.995E-32	306	0.335	0.386	P60651.pdb.gz	SPEB_ECOLI Agmatinase OS=Escherichia coli (strain K12) OX=83333 GN=speB PE=1 SV=1
6	PDB:7lbaB	0.754	0.853	2.028E-31	310	0.330	0.374	7lbaB.pdb.gz	Structure of the E. coli agmatinase, SPEB.
7	AFDB:A0A1D8PPP3	0.813	0.794	2.155E-31	361	0.287	0.280	A0A1D8PPP3.pdb.gz	A0A1D8PPP3_CANAL Agmatinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GBU1 PE=3 SV=1
8	AFDB:O42887	0.811	0.694	2.394E-30	413	0.315	0.269	O42887.pdb.gz	SPEB2_SCHPO Putative agmatinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC8E4.03 PE=3 SV=1
9	AFDB:Q5ANN8	0.716	0.608	1.413E-27	418	0.295	0.249	Q5ANN8.pdb.gz	Q5ANN8_CANAL Afp99p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AGT1 PE=3 SV=1
10	AFDB:Q5SJ85	0.722	0.862	2.502E-25	293	0.253	0.304	Q5SJ85.pdb.gz	SEPBH_THET8 N(1)-aminopropylagmatine ureohydrolase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA1129 PE=1 SV=1
11	AFDB:B8AU84	0.621	0.642	1.093E-22	340	0.256	0.265	B8AU84.pdb.gz	ARGI1_ORYSI Arginase 1, mitochondrial OS=Oryza sativa subsp. indica OX=39946 GN=B0616E02-H0507E05.7 PE=1 SV=1
12	AFDB:G7JFU5	0.665	0.691	1.568E-22	338	0.241	0.251	G7JFU5.pdb.gz	ARGI_MEDTR Arginase, mitochondrial OS=Medicago truncatula OX=3880 GN=ARGAH PE=1 SV=2
13	PDB:6vstD	0.659	0.722	4.105E-22	320	0.244	0.269	6vstD.pdb.gz	The Neighboring Subunit Is Engaged to Stabilize the Substrate in the Active Site of Plant Arginases.
14	PDB:6vsuE	0.652	0.719	9.390E-21	318	0.256	0.283	6vsuE.pdb.gz	The Neighboring Subunit Is Engaged to Stabilize the Substrate in the Active Site of Plant Arginases.
15	PDB:6dktE	0.626	0.813	5.627E-19	268	0.202	0.265	6dktE.pdb.gz	Structure of Arginase from Bacillus subtilis at 2.08 Angstroms resolution
16	PDB:6ss2AAA	0.643	0.703	1.663E-18	320	0.227	0.250	6ss2AAA.pdb.gz	Structural and functional characterization of C0021158, a high-affinity monoclonal antibody that inhibits Arginase 2 function via a novel non-competitive mechanism of action.
17	PDB:6nfpA	0.639	0.763	2.534E-18	292	0.207	0.250	6nfpA.pdb.gz	1.7 Angstrom Resolution Crystal Structure of Arginase from Bacillus subtilis subsp. subtilis str. 168
18	PDB:7k4gE	0.654	0.717	3.862E-18	319	0.210	0.232	7k4gE.pdb.gz	Comprehensive Strategies to Bicyclic Prolines: Applications in the Synthesis of Potent Arginase Inhibitors.
19	PDB:5zeeB	0.614	0.718	5.796E-17	297	0.168	0.199	5zeeB.pdb.gz	Structural insights into Entamoeba histolytica arginase and structure-based identification of novel non-amino acid based inhibitors as potential antiamoebic molecules.
20	PDB:1hqfA	0.634	0.706	9.963E-17	314	0.210	0.236	1hqfA.pdb.gz	Mechanistic and metabolic inferences from the binding of substrate analogues and products to arginase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BSE5	0.0	717	352	1.000	1.000	GDAH_HUMAN Guanidino acid hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=AGMAT PE=1 SV=2
2	Q9I3S3	1.56e-140	403	319	0.551	0.608	GBUA_PSEAE Guanidinobutyrase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=gbuA PE=1 SV=1
3	P60651	5.39e-58	192	306	0.315	0.363	SPEB_ECOLI Agmatinase OS=Escherichia coli (strain K12) OX=83333 GN=speB PE=1 SV=1
4	Q10088	7.09e-57	191	394	0.321	0.287	SPEB1_SCHPO Putative agmatinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC11D3.09 PE=3 SV=1
5	O42887	1.57e-49	173	413	0.324	0.276	SPEB2_SCHPO Putative agmatinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC8E4.03 PE=3 SV=1
6	A0A1D8PPP3	7.92e-46	162	361	0.290	0.283	A0A1D8PPP3_CANAL Agmatinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GBU1 PE=3 SV=1
7	Q5ANN8	7.37e-41	150	418	0.310	0.261	Q5ANN8_CANAL Afp99p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AGT1 PE=3 SV=1
8	P46637	4.19e-35	133	342	0.281	0.289	ARGI1_ARATH Arginase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ARGAH1 PE=1 SV=1
9	B8AU84	1.11e-33	129	340	0.276	0.285	ARGI1_ORYSI Arginase 1, mitochondrial OS=Oryza sativa subsp. indica OX=39946 GN=B0616E02-H0507E05.7 PE=1 SV=1
10	G7JFU5	1.25e-31	123	338	0.267	0.278	ARGI_MEDTR Arginase, mitochondrial OS=Medicago truncatula OX=3880 GN=ARGAH PE=1 SV=2
11	Q9ZPF5	2.41e-30	120	344	0.253	0.259	ARGI2_ARATH Arginase 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ARGAH2 PE=1 SV=1
12	Q5SJ85	1.93e-28	114	293	0.256	0.307	SEPBH_THET8 N(1)-aminopropylagmatine ureohydrolase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA1129 PE=1 SV=1
13	Q5JI38	4.94e-26	107	288	0.247	0.302	SPEBH_THEKO N(1)-aminopropylagmatine ureohydrolase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK0882 PE=1 SV=1
14	O08701	1.56e-17	84.7	354	0.233	0.232	ARGI2_RAT Arginase-2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Arg2 PE=1 SV=1
15	P78540	7.11e-17	82.8	354	0.239	0.237	ARGI2_HUMAN Arginase-2, mitochondrial OS=Homo sapiens OX=9606 GN=ARG2 PE=1 SV=1
16	P05089	2.85e-16	80.9	322	0.219	0.239	ARGI1_HUMAN Arginase-1 OS=Homo sapiens OX=9606 GN=ARG1 PE=1 SV=2
17	P39138	6.90e-16	79.3	296	0.224	0.267	ARGI_BACSU Arginase OS=Bacillus subtilis (strain 168) OX=224308 GN=rocF PE=1 SV=1
18	F1P5B4	1.36e-15	79.0	356	0.224	0.222	F1P5B4_CHICK Arginase OS=Gallus gallus OX=9031 GN=ARG2 PE=1 SV=4
19	P00812	4.05e-14	74.7	333	0.170	0.180	ARGI_YEAST Arginase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAR1 PE=1 SV=1
20	P07824	4.42e-14	74.3	323	0.210	0.229	ARGI1_RAT Arginase-1 OS=Rattus norvegicus OX=10116 GN=Arg1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00491 Arginase	2.5e-86	301.2	Arginase family
2	PF01601 CoV_S2	4e+02	11.0	Coronavirus spike glycoprotein S2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364986

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000294517	0.986	Antizyme inhibitor 2
2	9606.ENSP00000234111	0.974	Ornithine decarboxylase
3	9606.ENSP00000366156	0.966	Spermidine synthase
4	9606.ENSP00000368572	0.947	Diamine acetyltransferase 1
5	9606.ENSP00000411613	0.937	Amiloride-sensitive amine oxidase [copper-containing]
6	9606.ENSP00000269298	0.908	Diamine acetyltransferase 2
7	9606.ENSP00000357838	0.793	Ornithine aminotransferase, mitochondrial
8	9606.ENSP00000231420	0.721	Alanine--glyoxylate aminotransferase 2, mitochondrial
9	9606.ENSP00000263035	0.697	Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial
10	9606.ENSP00000357880	0.693	S-adenosylmethionine decarboxylase proenzyme
11	9606.ENSP00000264170	0.690	Kynureninase
12	9606.ENSP00000216392	0.684	Glycogen phosphorylase, liver form
13	9606.ENSP00000310447	0.675	Glutaminase liver isoform, mitochondrial
14	9606.ENSP00000341044	0.674	Acetyl-CoA carboxylase 2
15	9606.ENSP00000385746	0.673	Spermine synthase
16	9606.ENSP00000333666	0.670	1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
17	9606.ENSP00000005995	0.634	Testisin
18	9606.ENSP00000370737	0.625	Glycine dehydrogenase (decarboxylating), mitochondrial
19	9606.ENSP00000243563	0.624	U1 small nuclear ribonucleoprotein A
20	9606.ENSP00000356541	0.613	Splicing factor 3B subunit 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016813	1.000	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
GO:0005488	0.961	binding
GO:0005515	0.850	protein binding
GO:0008783	0.656	agmatinase activity
GO:0004053	0.417	arginase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0009058	0.979	biosynthetic process
GO:1901576	0.961	organic substance biosynthetic process
GO:1901566	0.954	organonitrogen compound biosynthetic process
GO:0009987	0.864	cellular process
GO:1901160	0.775	primary amino compound metabolic process
GO:0044237	0.709	cellular metabolic process
GO:0044238	0.519	primary metabolic process
GO:0044281	0.343	small molecule metabolic process
GO:0019752	0.323	carboxylic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.468	membrane
GO:0043233	0.304	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.5.3.-	1.000	In linear amidines.
RHEA:13929	0.656	agmatine + H2O = putrescine + urea
EC:3.5.3.11	0.656	agmatinase.
RHEA:20569	0.417	H2O + L-arginine = L-ornithine + urea
EC:3.5.3.1	0.417	arginase.

[back to server]