StarFunc result for job id Q9BSH4

User Input

>input (297 residues)
MSAWAAASLSRAAARCLLARGPGVRAAPPRDPRPSHPEPRGCGAAPGRTLHFTAAVPAGH
NKWSKVRHIKGPKDVERSRIFSKLCLNIRLAVKEGGPNPEHNSNLANILEVCRSKHMPKS
TIETALKMEKSKDTYLLYEGRGPGGSSLLIEALSNSSHKCQADIRHILNKNGGVMAVGAR
HSFDKKGVIVVEVEDREKKAVNLERALEMAIEAGAEDVKETEDEEERNVFKFICDASSLH
QVRKKLDSLGLCSVSCALEFIPNSKVQLAEPDLEQAAHLIQALSNHEDVIHVYDNIE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BSH4	1.000	1.000	8.234E-54	297	1.000	1.000	Q9BSH4.pdb.gz	TACO1_HUMAN Translational activator of cytochrome c oxidase 1 OS=Homo sapiens OX=9606 GN=TACO1 PE=1 SV=1
2	AFDB:Q8K0Z7	0.813	0.821	6.676E-45	294	0.778	0.786	Q8K0Z7.pdb.gz	TACO1_MOUSE Translational activator of cytochrome c oxidase 1 OS=Mus musculus OX=10090 GN=Taco1 PE=1 SV=1
3	PDB:5ekzA	0.608	0.785	2.527E-37	221	0.630	0.846	5ekzA.pdb.gz
4	AFDB:P62035	0.650	0.775	2.624E-23	247	0.263	0.316	P62035.pdb.gz	Y2259_DESVH Probable transcriptional regulatory protein DVU_2259 OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2259 PE=1 SV=1
5	AFDB:O43075	0.718	0.727	1.477E-22	293	0.290	0.294	O43075.pdb.gz	YGWC_SCHPO Probable transcriptional regulatory protein C8D2.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi053 PE=3 SV=2
6	AFDB:O51056	0.638	0.767	3.810E-22	243	0.236	0.288	O51056.pdb.gz	Y025_BORBU Probable transcriptional regulatory protein BB_0025 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0025 PE=3 SV=1
7	AFDB:P0A8A0	0.627	0.746	6.654E-22	246	0.253	0.305	P0A8A0.pdb.gz	YEBC_ECOLI Probable transcriptional regulatory protein YebC OS=Escherichia coli (strain K12) OX=83333 GN=yebC PE=1 SV=1
8	AFDB:O82314	0.691	0.625	2.268E-21	331	0.246	0.221	O82314.pdb.gz	U082_ARATH Probable transcriptional regulatory protein At2g25830 OS=Arabidopsis thaliana OX=3702 GN=At2g25830 PE=2 SV=2
9	AFDB:Q51423	0.616	0.726	2.536E-21	248	0.215	0.258	Q51423.pdb.gz	PMPR_PSEAE Transcriptional regulatory protein PmpR OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pmpR PE=1 SV=2
10	AFDB:P53212	0.693	0.708	2.109E-20	290	0.232	0.238	P53212.pdb.gz	YG1D_YEAST Probable transcriptional regulatory protein HAH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YGR021W PE=1 SV=1
11	AFDB:P0A8A2	0.620	0.759	2.493E-20	238	0.253	0.315	P0A8A2.pdb.gz	YEEN_ECOLI Probable transcriptional regulatory protein YeeN OS=Escherichia coli (strain K12) OX=83333 GN=yeeN PE=1 SV=1
12	PDB:1konA	0.588	0.733	2.158E-18	233	0.242	0.309	1konA.pdb.gz
13	PDB:2cyyA	0.146	0.237	8.891E-3	151	0.088	0.172	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
14	PDB:5iqr8	0.220	0.125	1.242E-2	615	0.067	0.033	5iqr8.pdb.gz	Ribosome-dependent activation of stringent control.
15	PDB:1ul3A	0.191	0.468	1.313E-2	95	0.054	0.168	1ul3A.pdb.gz	The structures of the PII proteins from the cyanobacteria Synechococcus sp. PCC 7942 and Synechocystis sp. PCC 6803.
16	PDB:6u9hG	0.213	0.312	1.940E-2	169	0.047	0.083	6u9hG.pdb.gz	Structures of fungal and plant acetohydroxyacid synthases.
17	PDB:5kpv33	0.184	0.099	3.582E-2	675	0.111	0.049	5kpv33.pdb.gz	Ribosome•RelA structures reveal the mechanism of stringent response activation.
18	PDB:7nshBC	0.178	0.086	4.234E-2	700	0.091	0.039	7nshBC.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
19	PDB:6mrjB	0.206	0.362	5.005E-2	142	0.061	0.127	6mrjB.pdb.gz	Crystal structure of H.pylori NikR in complex with DNA
20	PDB:4c3kD	0.174	0.387	5.916E-2	101	0.034	0.099	4c3kD.pdb.gz	Structural Basis and Target-Specific Modulation of Adp Sensing by the Synechococcus Elongatus Pii Signaling Protein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BSH4	0.0	608	297	1.000	1.000	TACO1_HUMAN Translational activator of cytochrome c oxidase 1 OS=Homo sapiens OX=9606 GN=TACO1 PE=1 SV=1
2	Q8K0Z7	1.82e-159	447	294	0.778	0.786	TACO1_MOUSE Translational activator of cytochrome c oxidase 1 OS=Mus musculus OX=10090 GN=Taco1 PE=1 SV=1
3	P62035	7.81e-36	130	247	0.263	0.316	Y2259_DESVH Probable transcriptional regulatory protein DVU_2259 OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2259 PE=1 SV=1
4	O43075	6.48e-34	127	293	0.296	0.300	YGWC_SCHPO Probable transcriptional regulatory protein C8D2.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi053 PE=3 SV=2
5	P0A8A0	2.29e-33	124	246	0.269	0.325	YEBC_ECOLI Probable transcriptional regulatory protein YebC OS=Escherichia coli (strain K12) OX=83333 GN=yebC PE=1 SV=1
6	P0A8A2	1.31e-30	117	238	0.269	0.336	YEEN_ECOLI Probable transcriptional regulatory protein YeeN OS=Escherichia coli (strain K12) OX=83333 GN=yeeN PE=1 SV=1
7	O51056	9.69e-26	104	243	0.242	0.296	Y025_BORBU Probable transcriptional regulatory protein BB_0025 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0025 PE=3 SV=1
8	Q51423	1.41e-25	103	248	0.232	0.278	PMPR_PSEAE Transcriptional regulatory protein PmpR OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pmpR PE=1 SV=2
9	P53212	1.53e-21	94.0	290	0.256	0.262	YG1D_YEAST Probable transcriptional regulatory protein HAH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YGR021W PE=1 SV=1
10	O82314	2.53e-20	91.3	331	0.239	0.215	U082_ARATH Probable transcriptional regulatory protein At2g25830 OS=Arabidopsis thaliana OX=3702 GN=At2g25830 PE=2 SV=2
11	D2IYK3	0.77	33.5	360	0.077	0.064	D2IYK3_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU5F1 PE=2 SV=1
12	Q01860	0.77	33.5	360	0.077	0.064	PO5F1_HUMAN POU domain, class 5, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU5F1 PE=1 SV=1
13	F1R9Y1	2.9	32.3	1864	0.040	0.006	F1R9Y1_DANRE Collagen alpha-1(XIV) chain isoform X2 OS=Danio rerio OX=7955 GN=col14a1a PE=1 SV=1
14	Q64GK4	3.0	32.0	1382	0.091	0.020	Q64GK4_DANRE Hepatocyte growth factor receptor OS=Danio rerio OX=7955 GN=cmet PE=2 SV=1
15	F1QLR7	3.1	32.0	1382	0.091	0.020	F1QLR7_DANRE Hepatocyte growth factor receptor OS=Danio rerio OX=7955 GN=c-met PE=4 SV=1
16	A0A0A0MRZ4	3.3	32.0	619	0.084	0.040	A0A0A0MRZ4_HUMAN TNFAIP3 interacting protein 1 OS=Homo sapiens OX=9606 GN=TNIP1 PE=1 SV=1
17	Q9LJL9	5.1	31.2	599	0.084	0.042	CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana OX=3702 GN=CRK2 PE=1 SV=1
18	P0AEP9	5.9	30.8	499	0.084	0.050	GLCD_ECOLI Glycolate oxidase subunit GlcD OS=Escherichia coli (strain K12) OX=83333 GN=glcD PE=1 SV=1
19	P14618	9.1	30.4	531	0.135	0.075	KPYM_HUMAN Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4
20	V9HWB8	9.1	30.4	531	0.135	0.075	V9HWB8_HUMAN Pyruvate kinase OS=Homo sapiens OX=9606 GN=HEL-S-30 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01709 Transcrip_reg	3.5e-61	218.2	Transcriptional regulator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258975

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307786	0.908	Cytochrome c
2	9606.ENSP00000016171	0.878	Cytochrome c oxidase assembly protein COX15 homolog
3	9606.ENSP00000354762	0.874	Cytochrome c oxidase assembly factor 3 homolog, mitochondrial
4	9606.ENSP00000320658	0.873	Tyrosine--tRNA ligase, mitochondrial
5	9606.ENSP00000261643	0.839	Protoheme IX farnesyltransferase, mitochondrial
6	9606.ENSP00000446524	0.807	Cytochrome c oxidase assembly protein COX14
7	9606.ENSP00000260665	0.806	Leucine-rich PPR motif-containing protein, mitochondrial
8	9606.ENSP00000313877	0.798	Elongation factor Ts, mitochondrial
9	9606.ENSP00000299432	0.794	Putative protein MSS51 homolog, mitochondrial
10	9606.ENSP00000354499	0.769	Cytochrome c oxidase subunit 1
11	9606.ENSP00000255390	0.748	Protein SCO1 homolog, mitochondrial
12	9606.ENSP00000332340	0.744	Probable ATP-dependent RNA helicase DDX28
13	9606.ENSP00000406327	0.732	Cytochrome c oxidase protein 20 homolog
14	9606.ENSP00000377616	0.723	Keratin-like protein KRT222
15	9606.ENSP00000442563	0.718	DNA polymerase subunit gamma-2, mitochondrial
16	9606.ENSP00000362036	0.716	Mitochondrial ribosomal protein S16
17	9606.ENSP00000301585	0.713	Peptidyl-tRNA hydrolase ICT1, mitochondrial
18	9606.ENSP00000419038	0.713	Elongation factor G, mitochondrial
19	9606.ENSP00000400168	0.707	ATP5J2-PTCD1 readthrough
20	9606.ENSP00000423399	0.706	Mitochondrial ribosomal protein L36

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.946	heterocyclic compound binding
GO:0097159	0.946	organic cyclic compound binding
GO:0003676	0.926	nucleic acid binding
GO:0003723	0.911	RNA binding
GO:0043022	0.515	ribosome binding
GO:0019843	0.481	rRNA binding
GO:0003729	0.441	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007005	0.986	mitochondrion organization
GO:0043933	0.985	protein-containing complex organization
GO:0065003	0.982	protein-containing complex assembly
GO:0010608	0.975	post-transcriptional regulation of gene expression
GO:0010556	0.969	regulation of macromolecule biosynthetic process
GO:0031326	0.969	regulation of cellular biosynthetic process
GO:0033108	0.963	mitochondrial respiratory chain complex assembly
GO:0006417	0.959	regulation of translation
GO:0062125	0.955	regulation of mitochondrial gene expression
GO:0070129	0.947	regulation of mitochondrial translation
GO:0017004	0.883	cytochrome complex assembly
GO:0008535	0.830	respiratory chain complex IV assembly
GO:0008152	0.648	metabolic process
GO:0044237	0.594	cellular metabolic process
GO:0071704	0.453	organic substance metabolic process
GO:0006807	0.438	nitrogen compound metabolic process
GO:0044238	0.398	primary metabolic process
GO:0033617	0.386	mitochondrial cytochrome c oxidase assembly
GO:0032501	0.336	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.796	intracellular organelle lumen
GO:0016020	0.557	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]