StarFunc result for job id Q9BSI4

User Input

>input (451 residues)
MATPLVAGPAALRFAAAASWQVVRGRCVEHFPRVLEFLRSLRAVAPGLVRYRHHERLCMG
LKAKVVVELILQGRPWAQVLKALNHHFPESGPIVRDPKATKQDLRKILEAQETFYQQVKQ
LSEAPVDLASKLQELEQEYGEPFLAAMEKLLFEYLCQLEKALPTPQAQQLQDVLSWMQPG
VSITSSLAWRQYGVDMGWLLPECSVTDSVNLAEPMEQNPPQQQRLALHNPLPKAKPGTHL
PQGPSSRTHPEPLAGRHFNLAPLGRRRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVI
SKPESKEEHAIYTADLAMGTRAASTGKSKSPCQTLGGRALKENPVDLPATEQKENCLDCY
MDPLRLSLLPPRARKPVCPPSLCSSVITIGDLVLDSDEEENGQGEGKESLENYQKTKFDT
LIPTLCEYLPPSGHGAIPVSSCDCRDSSRPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BSI4	1.000	1.000	5.066E-57	451	1.000	1.000	Q9BSI4.pdb.gz	TINF2_HUMAN TERF1-interacting nuclear factor 2 OS=Homo sapiens OX=9606 GN=TINF2 PE=1 SV=1
2	AFDB:B4DFJ1	0.346	0.373	4.246E-40	416	0.920	0.998	B4DFJ1.pdb.gz	B4DFJ1_HUMAN TERF1 interacting nuclear factor 2 OS=Homo sapiens OX=9606 GN=TINF2 PE=1 SV=1
3	AFDB:Q9PU53	0.220	0.149	4.791E-2	718	0.137	0.086	Q9PU53.pdb.gz	TERF2_CHICK Telomeric repeat-binding factor 2 OS=Gallus gallus OX=9031 GN=TERF2 PE=1 SV=2
4	AFDB:F4HRS2	0.089	0.029	8.750E-2	2222	0.151	0.031	F4HRS2.pdb.gz	SWTIE_ARATH Protein SWEETIE OS=Arabidopsis thaliana OX=3702 GN=SWEETIE PE=1 SV=2
5	AFDB:O42130	0.071	0.032	3.202E-1	1553	0.149	0.043	O42130.pdb.gz	TOP2A_CHICK DNA topoisomerase 2-alpha OS=Gallus gallus OX=9031 GN=TOP2A PE=2 SV=2
6	AFDB:A2A690	0.140	0.046	3.513E-1	1994	0.160	0.036	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
7	AFDB:P50275	0.091	0.053	3.680E-1	885	0.124	0.063	P50275.pdb.gz	ASE1_YEAST Anaphase spindle elongation protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ASE1 PE=1 SV=1
8	AFDB:A0A0G2JW74	0.086	0.059	4.429E-1	764	0.146	0.086	A0A0G2JW74.pdb.gz	A0A0G2JW74_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif18a PE=3 SV=2
9	AFDB:X4YX01	0.077	0.029	4.859E-1	1648	0.126	0.035	X4YX01.pdb.gz	X4YX01_DROME Wide awake OS=Drosophila melanogaster OX=7227 GN=wake PE=2 SV=1
10	AFDB:P40068	0.075	0.051	6.417E-1	799	0.135	0.076	P40068.pdb.gz	FLO8_YEAST Transcriptional activator FLO8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FLO8 PE=5 SV=2
11	PDB:5nugA	0.092	0.020	9.040E-1	2920	0.053	0.008	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
12	PDB:7jsjA	0.079	0.077	9.469E-1	468	0.062	0.060	7jsjA.pdb.gz	Structure and inhibition mechanism of the human citrate transporter NaCT.
13	PDB:7p5jA	0.078	0.086	1.576	399	0.069	0.078	7p5jA.pdb.gz
14	PDB:6faii	0.108	0.167	1.811	262	0.051	0.088	6faii.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
15	PDB:7uw9i	0.082	0.192	1.897	156	0.049	0.141	7uw9i.pdb.gz
16	PDB:6wlw0	0.105	0.197	2.284	204	0.044	0.098	6wlw0.pdb.gz	Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.
17	PDB:5lqwQ	0.114	0.073	2.392	791	0.044	0.025	5lqwQ.pdb.gz	Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
18	PDB:7p54A	0.100	0.111	2.392	397	0.053	0.060	7p54A.pdb.gz
19	PDB:6wgeB	0.080	0.074	2.505	490	0.040	0.037	6wgeB.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
20	PDB:7qenD	0.126	0.063	2.749	1050	0.049	0.021	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DFJ1	0.0	835	416	0.922	1.000	B4DFJ1_HUMAN TERF1 interacting nuclear factor 2 OS=Homo sapiens OX=9606 GN=TINF2 PE=1 SV=1
2	Q9BSI4	0.0	924	451	1.000	1.000	TINF2_HUMAN TERF1-interacting nuclear factor 2 OS=Homo sapiens OX=9606 GN=TINF2 PE=1 SV=1
3	Q9QXG9	3.75e-140	407	341	0.486	0.642	TINF2_MOUSE TERF1-interacting nuclear factor 2 OS=Mus musculus OX=10090 GN=Tinf2 PE=1 SV=2
4	H0YKA6	6.32e-103	304	146	0.324	1.000	H0YKA6_HUMAN TERF1 interacting nuclear factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=TINF2 PE=1 SV=1
5	F1R9M2	6.68e-16	82.4	585	0.140	0.108	F1R9M2_DANRE TERF1 (TRF1)-interacting nuclear factor 2 OS=Danio rerio OX=7955 GN=tinf2 PE=1 SV=1
6	F1QGF1	4.52e-07	54.7	1111	0.102	0.041	F1QGF1_DANRE Uncharacterized protein LOC503753 OS=Danio rerio OX=7955 GN=zgc:113263 PE=1 SV=3
7	B1AWL2	1.6	33.9	2495	0.062	0.011	ZN462_MOUSE Zinc finger protein 462 OS=Mus musculus OX=10090 GN=Znf462 PE=1 SV=1
8	Q96JM2	1.6	33.9	2506	0.062	0.011	ZN462_HUMAN Zinc finger protein 462 OS=Homo sapiens OX=9606 GN=ZNF462 PE=1 SV=3
9	Q8IHP9	4.9	32.3	2940	0.033	0.005	Q8IHP9_PLAF7 Sporozoite and liver stage asparagine-rich protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1147000 PE=4 SV=1
10	F1NP39	5.4	32.0	672	0.047	0.031	F1NP39_CHICK Protein-arginine deiminase OS=Gallus gallus OX=9031 GN=cPAD3 PE=1 SV=1
11	Q94A51	6.2	32.0	805	0.038	0.021	PUB32_ARATH U-box domain-containing protein 32 OS=Arabidopsis thaliana OX=3702 GN=PUB32 PE=1 SV=1
12	Q96AQ6	6.6	31.6	731	0.069	0.042	PBIP1_HUMAN Pre-B-cell leukemia transcription factor-interacting protein 1 OS=Homo sapiens OX=9606 GN=PBXIP1 PE=1 SV=1
13	Q57WX6	7.5	31.6	4639	0.031	0.003	Q57WX6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.490 PE=4 SV=1
14	Q96DY5	8.9	31.2	654	0.049	0.034	RN112_MOUSE RING finger protein 112 OS=Mus musculus OX=10090 GN=Rnf112 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14973 TINF2_N	1.4e-48	176.4	TERF1-interacting nuclear factor 2 N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267415

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254942	0.999	Telomeric repeat-binding factor 2
2	9606.ENSP00000276603	0.999	Telomeric repeat-binding factor 1
3	9606.ENSP00000300086	0.999	Telomeric repeat-binding factor 2-interacting protein 1
4	9606.ENSP00000350249	0.999	Protection of telomeres protein 1
5	9606.ENSP00000483117	0.999	Adrenocortical dysplasia protein homolog
6	9606.ENSP00000336687	0.988	Chromobox protein homolog 3
7	9606.ENSP00000358576	0.986	5' exonuclease Apollo
8	9606.ENSP00000298139	0.978	Werner syndrome ATP-dependent helicase
9	9606.ENSP00000313759	0.958	CST complex subunit CTC1
10	9606.ENSP00000332198	0.948	H/ACA ribonucleoprotein complex subunit 3
11	9606.ENSP00000358563	0.946	H/ACA ribonucleoprotein complex subunit 4
12	9606.ENSP00000274606	0.941	H/ACA ribonucleoprotein complex subunit 2
13	9606.ENSP00000299427	0.940	Tripeptidyl-peptidase 1
14	9606.ENSP00000305480	0.938	Flap endonuclease 1
15	9606.ENSP00000347232	0.931	Bloom syndrome protein
16	9606.ENSP00000311579	0.930	Tankyrase-1
17	9606.ENSP00000328174	0.930	ATP-dependent DNA helicase PIF1
18	9606.ENSP00000377390	0.928	Serine/threonine-protein phosphatase 6 regulatory subunit 3
19	9606.ENSP00000380762	0.925	CST complex subunit TEN1
20	9606.ENSP00000352257	0.923	X-ray repair cross-complementing protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042162	1.000	telomeric DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.991	primary metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0071704	0.990	organic substance metabolic process
GO:0050794	0.990	regulation of cellular process
GO:0032200	0.985	telomere organization
GO:0033044	0.983	regulation of chromosome organization
GO:2000278	0.983	regulation of DNA biosynthetic process
GO:0000723	0.983	telomere maintenance
GO:0065009	0.964	regulation of molecular function
GO:0051179	0.953	localization
GO:0010605	0.951	negative regulation of macromolecule metabolic process
GO:0032210	0.945	regulation of telomere maintenance via telomerase
GO:0033036	0.939	macromolecule localization
GO:0045934	0.928	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.922	negative regulation of cellular biosynthetic process
GO:0051053	0.922	negative regulation of DNA metabolic process
GO:0010558	0.921	negative regulation of macromolecule biosynthetic process
GO:0051129	0.918	negative regulation of cellular component organization
GO:0034502	0.915	protein localization to chromosome
GO:2001251	0.910	negative regulation of chromosome organization
GO:0050790	0.904	regulation of catalytic activity
GO:2000279	0.871	negative regulation of DNA biosynthetic process
GO:0016233	0.853	telomere capping
GO:0051338	0.832	regulation of transferase activity
GO:0022607	0.737	cellular component assembly
GO:0050896	0.475	response to stimulus
GO:0048518	0.414	positive regulation of biological process
GO:1904357	0.364	negative regulation of telomere maintenance via telomere lengthening
GO:0044092	0.323	negative regulation of molecular function
GO:0051716	0.321	cellular response to stimulus
GO:0048522	0.309	positive regulation of cellular process
GO:0006950	0.302	response to stress
GO:0043086	0.300	negative regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016604	0.999	nuclear body
GO:0032991	0.998	protein-containing complex
GO:0005694	0.998	chromosome
GO:0000781	0.987	chromosome, telomeric region
GO:0032993	0.979	protein-DNA complex
GO:0140513	0.979	nuclear protein-containing complex
GO:0044815	0.964	DNA packaging complex
GO:0000783	0.800	nuclear telomere cap complex
GO:0005737	0.699	cytoplasm
GO:0010369	0.484	chromocenter
GO:0070187	0.391	shelterin complex
GO:0010370	0.372	perinucleolar chromocenter

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]