StarFunc result for job id Q9BSJ5

User Input

>input (609 residues)
MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTIPTDQKVYQSKPATLPRAKKMKGPIK
DLIKAKGKELETENEERNSKLVVDKPEQTVKTFPLPAVGLERAATTKADKDIKNPIQPSF
KMLKNTKPMTTFQEETKAQFYASEKTSPKRELAKDLPKSGESRCNPSEAGASLLVGSIEP
SLSNQDRKYSSTLPNDVQTTSGDLKLDKIDPQRQELLVKLLDVPTGDCHISPKNVSDGVK
RVRTLLSNERDSKGRDHLSGVPTDVTVTETPEKNTESLILSLKMSSLGKIQVMEKQEKGL
TLGVETCGSKGNAEKSMSATEKQERTVMSHGCENFNTRDSVTGKESQGERPHLSLFIPRE
TTYQFHSVSQSSSQSLASLATTFLQEKKAEAQNHHCVPDVKALMESPEGQLSLEPKSDSQ
FQASHTGCQSPLCSAQRHTPQSPFTNHAAAAGRKTLRSCMGLEWFPELYPGYLGLGVLPG
KPQCWNAMTQKPQLISPQGERLSQVSLLERSSTHIRSLEPPAGLTTSNFSLMRLLGAVQK
GWIRCNTTIRKSGFGGITMLFTGYFVLCCSWSFRRLKKLCRPLPWKSTVPPCIGVAKTTG
DCRSKTCLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BSJ5	0.999	0.999	1.075E-83	609	1.000	1.000	Q9BSJ5.pdb.gz	CQ080_HUMAN Uncharacterized protein C17orf80 OS=Homo sapiens OX=9606 GN=C17orf80 PE=1 SV=2
2	AFDB:P17564	0.064	0.060	5.088E-2	657	0.164	0.152	P17564.pdb.gz	PR15A_MOUSE Protein phosphatase 1 regulatory subunit 15A OS=Mus musculus OX=10090 GN=Ppp1r15a PE=1 SV=1
3	AFDB:P34333	0.058	0.024	5.440E-2	1778	0.153	0.052	P34333.pdb.gz	NCOR1_CAEEL Nuclear receptor corepressor 1 OS=Caenorhabditis elegans OX=6239 GN=gei-8 PE=1 SV=4
4	AFDB:Q0D3B6	0.061	0.053	7.108E-2	742	0.148	0.121	Q0D3B6.pdb.gz	PRR37_ORYSJ Two-component response regulator-like PRR37 OS=Oryza sativa subsp. japonica OX=39947 GN=PRR37 PE=2 SV=1
5	AFDB:P15806	0.060	0.057	7.600E-2	651	0.166	0.155	P15806.pdb.gz	TFE2_MOUSE Transcription factor E2-alpha OS=Mus musculus OX=10090 GN=Tcf3 PE=1 SV=2
6	AFDB:R4GMT7	0.065	0.068	2.072E-1	580	0.141	0.148	R4GMT7.pdb.gz	R4GMT7_HUMAN Transforming acidic coiled-coil containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=1
7	AFDB:Q56A10	0.061	0.032	2.707E-1	1511	0.149	0.060	Q56A10.pdb.gz	ZN608_MOUSE Zinc finger protein 608 OS=Mus musculus OX=10090 GN=Znf608 PE=1 SV=1
8	AFDB:S4R3N7	0.057	0.047	2.707E-1	796	0.186	0.142	S4R3N7.pdb.gz	S4R3N7_HUMAN Chromosome 10 open reading frame 90 OS=Homo sapiens OX=9606 GN=C10orf90 PE=1 SV=3
9	AFDB:B1AR10	0.062	0.038	3.094E-1	1109	0.126	0.069	B1AR10.pdb.gz	B1AR10_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
10	AFDB:Q93073	0.058	0.037	4.043E-1	1101	0.128	0.071	Q93073.pdb.gz	SBP2L_HUMAN Selenocysteine insertion sequence-binding protein 2-like OS=Homo sapiens OX=9606 GN=SECISBP2L PE=1 SV=3
11	PDB:7odrd	0.031	0.064	3.252	259	0.015	0.035	7odrd.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
12	PDB:3w5kB	0.037	0.174	5.552	110	0.010	0.055	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
13	PDB:6t9lN	0.036	0.234	5.552	82	0.015	0.110	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.
14	PDB:7edxH	0.061	0.134	8.292	209	0.021	0.062	7edxH.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
15	PDB:7pfoQ	0.040	0.259	8.292	79	0.015	0.114	7pfoQ.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BSJ5	0.0	1255	609	1.000	1.000	CQ080_HUMAN Uncharacterized protein C17orf80 OS=Homo sapiens OX=9606 GN=C17orf80 PE=1 SV=2
2	P56134	0.013	37.7	94	0.036	0.234	ATPK_HUMAN ATP synthase subunit f, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MF PE=1 SV=3
3	C9JU26	0.042	36.6	98	0.031	0.194	C9JU26_HUMAN ATP synthase subunit f, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MF PE=1 SV=1
4	P56135	0.13	34.7	88	0.034	0.239	ATPK_MOUSE ATP synthase subunit f, mitochondrial OS=Mus musculus OX=10090 GN=Atp5mf PE=1 SV=3
5	O22248	0.35	36.2	351	0.064	0.111	O22248_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL9 PE=1 SV=2
6	Q58CQ2	3.4	32.7	372	0.034	0.056	ARC1B_BOVIN Actin-related protein 2/3 complex subunit 1B OS=Bos taurus OX=9913 GN=ARPC1B PE=1 SV=4
7	Q9NRD9	4.0	33.1	1551	0.026	0.010	DUOX1_HUMAN Dual oxidase 1 OS=Homo sapiens OX=9606 GN=DUOX1 PE=1 SV=1
8	A2AQ92	4.1	33.1	1551	0.026	0.010	A2AQ92_MOUSE NAD(P)H oxidase (H2O2-forming) OS=Mus musculus OX=10090 GN=Duox1 PE=1 SV=1
9	Q8BZ02	4.4	32.7	1058	0.026	0.015	Q8BZ02_MOUSE NAD(P)H oxidase (H2O2-forming) (Fragment) OS=Mus musculus OX=10090 GN=Duox1 PE=2 SV=1
10	P34926	6.1	32.3	2774	0.025	0.005	MAP1A_RAT Microtubule-associated protein 1A OS=Rattus norvegicus OX=10116 GN=Map1a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351937

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306003	0.963	ATP synthase subunit e, mitochondrial
2	9606.ENSP00000389649	0.945	ATP synthase-coupling factor 6, mitochondrial
3	9606.ENSP00000301587	0.920	ATP synthase subunit d, mitochondrial
4	9606.ENSP00000358737	0.900	ATP synthase F(0) complex subunit B1, mitochondrial
5	9606.ENSP00000215375	0.899	ATP synthase subunit delta, mitochondrial
6	9606.ENSP00000349142	0.888	ATP synthase subunit gamma, mitochondrial
7	9606.ENSP00000421076	0.833	ATP synthase subunit g 2, mitochondrial
8	9606.ENSP00000290299	0.810	ATP synthase subunit O, mitochondrial
9	9606.ENSP00000394107	0.810	annotation not available
10	9606.ENSP00000381736	0.803	ATP synthase subunit alpha, mitochondrial
11	9606.ENSP00000262030	0.800	ATP synthase subunit beta, mitochondrial
12	9606.ENSP00000418842	0.745	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
13	9606.ENSP00000317780	0.737	Cytochrome c oxidase subunit 5A, mitochondrial
14	9606.ENSP00000428895	0.731	Cytochrome c oxidase subunit 6C
15	9606.ENSP00000458770	0.724	Acyl carrier protein, mitochondrial
16	9606.ENSP00000300688	0.722	ATP synthase subunit g, mitochondrial
17	9606.ENSP00000268668	0.708	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
18	9606.ENSP00000243997	0.706	ATP synthase subunit epsilon, mitochondrial
19	9606.ENSP00000370414	0.706	ATP synthase subunit epsilon-like protein, mitochondrial
20	9606.ENSP00000330433	0.703	TM2 domain containing 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0044237	0.966	cellular metabolic process
GO:0065007	0.917	biological regulation
GO:0050789	0.850	regulation of biological process
GO:0050794	0.755	regulation of cellular process
GO:0071704	0.569	organic substance metabolic process
GO:0006807	0.559	nitrogen compound metabolic process
GO:0044238	0.506	primary metabolic process
GO:0071840	0.471	cellular component organization or biogenesis
GO:0034641	0.470	cellular nitrogen compound metabolic process
GO:0016043	0.445	cellular component organization
GO:0046483	0.431	heterocycle metabolic process
GO:0006725	0.400	cellular aromatic compound metabolic process
GO:0006996	0.385	organelle organization
GO:0031323	0.379	regulation of cellular metabolic process
GO:0006091	0.355	generation of precursor metabolites and energy
GO:0015980	0.329	energy derivation by oxidation of organic compounds
GO:0006139	0.329	nucleobase-containing compound metabolic process
GO:0045333	0.303	cellular respiration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070062	0.996	extracellular exosome
GO:0043231	0.936	intracellular membrane-bounded organelle
GO:0005737	0.925	cytoplasm
GO:0005739	0.878	mitochondrion
GO:0032991	0.505	protein-containing complex
GO:0016020	0.426	membrane
GO:0005634	0.398	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]