StarFunc result for job id Q9BSJ8

User Input

>input (1104 residues)
MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGR
RLLVLIPVYLAGAVGLSVGFVLFGLALYLGWRRVRDEKERSLRAARQLLDDEEQLTAKTL
YMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFT
FTRVELGEKPLRIIGVKVHPGQRKEQILLDLNISYVGDVQIDVEVKKYFCKAGVKGMQLH
GVLRVILEPLIGDLPFVGAVSMFFIRRPTLDINWTGMTNLLDIPGLSSLSDTMIMDSIAA
FLVLPNRLLVPLVPDLQDVAQLRSPLPRGIIRIHLLAARGLSSKDKYVKGLIEGKSDPYA
LVRLGTQTFCSRVIDEELNPQWGETYEVMVHEVPGQEIEVEVFDKDPDKDDFLGRMKLDV
GKVLQASVLDDWFPLQGGQGQVHLRLEWLSLLSDAEKLEQVLQWNWGVSSRPDPPSAAIL
VVYLDRAQDLPLKKGNKEPNPMVQLSIQDVTQESKAVYSTNCPVWEEAFRFFLQDPQSQE
LDVQVKDDSRALTLGALTLPLARLLTAPELILDQWFQLSSSGPNSRLYMKLVMRILYLDS
SEICFPTVPGCPGAWDVDSENPQRGSSVDAPPRPCHTTPDSQFGTEHVLRIHVLEAQDLI
AKDRFLGGLVKGKSDPYVKLKLAGRSFRSHVVREDLNPRWNEVFEVIVTSVPGQELEVEV
FDKDLDKDDFLGRCKVRLTTVLNSGFLDEWLTLEDVPSGRLHLRLERLTPRPTAAELEEV
LQVNSLIQTQKSAELAAALLSIYMERAEDLPLRKGTKHLSPYATLTVGDSSHKTKTISQT
SAPVWDESASFLIRKPHTESLELQVRGEGTGVLGSLSLPLSELLVADQLCLDRWFTLSSG
QGQVLLRAQLGILVSQHSGVEAHSHSYSHSSSSLSEEPELSGGPPHITSSAPELRQRLTH
VDSPLEAPAGPLGQVKLTLWYYSEERKLVSIVHGCRSLRQNGRDPPDPYVSLLLLPDKNR
GTKRRTSQKKRTLSPEFNERFEWELPLDEAQRRKLDVSVKSNSSFMSRERELLGKVQLDL
AETDLSQGVARWYDLMDNKDKGSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RB16	0.436	0.432	0.000	1114	1.000	0.991	A0A024RB16.pdb.gz
2	AFDB:Q3U7R1	0.500	0.505	0.000	1092	0.872	0.882	Q3U7R1.pdb.gz	ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus OX=10090 GN=Esyt1 PE=1 SV=2
3	AFDB:H7BXI1	0.419	0.532	2.357E-82	866	0.345	0.440	H7BXI1.pdb.gz	H7BXI1_HUMAN Extended synaptotagmin 2 OS=Homo sapiens OX=9606 GN=ESYT2 PE=1 SV=2
4	AFDB:A0FGR8	0.435	0.518	3.144E-82	921	0.352	0.422	A0FGR8.pdb.gz	ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2 PE=1 SV=1
5	AFDB:A0FGR9	0.435	0.535	1.059E-76	886	0.312	0.388	A0FGR9.pdb.gz	ESYT3_HUMAN Extended synaptotagmin-3 OS=Homo sapiens OX=9606 GN=ESYT3 PE=1 SV=1
6	AFDB:Q9UT00	0.252	0.237	4.335E-52	1225	0.158	0.142	Q9UT00.pdb.gz	YKH3_SCHPO Uncharacterized protein PYUK71.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPYUK71.03c PE=1 SV=1
7	AFDB:Q03640	0.213	0.156	1.032E-50	1545	0.176	0.126	Q03640.pdb.gz	TCB3_YEAST Tricalbin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TCB3 PE=1 SV=1
8	AFDB:A0A1D8PCX0	0.219	0.175	5.814E-50	1417	0.177	0.138	A0A1D8PCX0.pdb.gz	A0A1D8PCX0_CANAL Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TCB3 PE=4 SV=1
9	AFDB:O14065	0.208	0.171	8.538E-50	1429	0.153	0.118	O14065.pdb.gz	YC31_SCHPO Uncharacterized protein C962.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC962.01 PE=2 SV=3
10	AFDB:P48231	0.260	0.246	7.777E-49	1178	0.173	0.162	P48231.pdb.gz	TCB2_YEAST Tricalbin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TCB2 PE=1 SV=1
11	PDB:5iz5B	0.130	0.177	3.442E-12	746	0.049	0.072	5iz5B.pdb.gz
12	PDB:5iz5A	0.129	0.174	6.426E-12	757	0.047	0.069	5iz5A.pdb.gz
13	PDB:6kxkD	0.118	0.213	8.993E-12	553	0.051	0.101	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
14	PDB:5ixcA	0.124	0.185	4.843E-10	684	0.044	0.072	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5izrC	0.118	0.178	9.954E-10	659	0.040	0.067	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:5a52A	0.101	0.685	1.153E-8	154	0.030	0.214	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
17	PDB:5a50A	0.103	0.651	4.018E-8	165	0.032	0.212	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:4rj9A	0.102	0.662	4.423E-8	161	0.034	0.230	4rj9A.pdb.gz
19	PDB:3pfqA	0.107	0.221	7.871E-8	523	0.030	0.063	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
20	PDB:1cjyA	0.106	0.181	1.272E-7	633	0.027	0.047	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A499FIX8	0.0	584	845	0.265	0.347	A0A499FIX8_HUMAN Extended synaptotagmin 2 OS=Homo sapiens OX=9606 GN=ESYT2 PE=1 SV=1
2	A0FGR8	0.0	592	921	0.273	0.327	ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2 PE=1 SV=1
3	H7BXI1	0.0	578	866	0.267	0.341	H7BXI1_HUMAN Extended synaptotagmin 2 OS=Homo sapiens OX=9606 GN=ESYT2 PE=1 SV=2
4	Q3U7R1	0.0	1851	1092	0.871	0.881	ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus OX=10090 GN=Esyt1 PE=1 SV=2
5	Q9BSJ8	0.0	2231	1104	1.000	1.000	ESYT1_HUMAN Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1
6	A0FGR9	1.13e-149	471	886	0.236	0.293	ESYT3_HUMAN Extended synaptotagmin-3 OS=Homo sapiens OX=9606 GN=ESYT3 PE=1 SV=1
7	Q8L706	5.69e-43	167	560	0.137	0.270	SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana OX=3702 GN=SYT5 PE=2 SV=1
8	Q9SKR2	1.25e-36	148	541	0.129	0.262	SYT1_ARATH Synaptotagmin-1 OS=Arabidopsis thaliana OX=3702 GN=SYT1 PE=1 SV=2
9	B6ETT4	3.77e-35	144	537	0.125	0.257	SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana OX=3702 GN=SYT2 PE=2 SV=1
10	Q9LEX1	1.15e-34	142	510	0.091	0.198	CLB_ARATH Calcium-dependent lipid-binding protein OS=Arabidopsis thaliana OX=3702 GN=CLB PE=1 SV=1
11	F4IFM6	9.96e-31	131	579	0.130	0.247	F4IFM6_ARATH Synaptotagmin A OS=Arabidopsis thaliana OX=3702 GN=SYTA PE=1 SV=1
12	Q6DN12	6.87e-21	101	878	0.111	0.139	MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MCTP2 PE=1 SV=3
13	D4ABL6	8.21e-18	91.7	946	0.098	0.114	MCTP1_RAT Multiple C2 and transmembrane domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Mctp1 PE=1 SV=4
14	Q6DN14	1.28e-17	91.3	999	0.064	0.071	MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MCTP1 PE=2 SV=2
15	Q9UT00	2.06e-17	90.5	1225	0.131	0.118	YKH3_SCHPO Uncharacterized protein PYUK71.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPYUK71.03c PE=1 SV=1
16	Q9M2D4	6.92e-17	88.6	972	0.097	0.110	MCTP8_ARATH Multiple C2 domain and transmembrane region protein 8 OS=Arabidopsis thaliana OX=3702 GN=MCTP8 PE=2 SV=1
17	Q388M5	1.83e-15	83.6	594	0.081	0.150	Q388M5_TRYB2 Calcium-dependent lipid binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.3180 PE=1 SV=1
18	Q60EW9	2.62e-15	83.2	774	0.113	0.161	FTIP7_ORYSJ FT-interacting protein 7 OS=Oryza sativa subsp. japonica OX=39947 GN=FTIP7 PE=1 SV=1
19	F4JD16	3.45e-14	79.3	627	0.062	0.108	F4JD16_ARATH C2 calcium/lipid-binding endonuclease/exonuclease/phosphatase OS=Arabidopsis thaliana OX=3702 GN=At3g60950 PE=3 SV=1
20	A1ZBD6	4.36e-14	79.7	912	0.061	0.073	MCTP_DROME Multiple C2 and transmembrane domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Mctp PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	1.7e-93	319.0	C2 domain
2	PF17047 SMP_LBD	2.4e-76	266.7	Synaptotagmin-like mitochondrial-lipid-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267113

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251527	0.939	Extended synaptotagmin-2
2	9606.ENSP00000374218	0.907	Extended synaptotagmin-3
3	9606.ENSP00000320935	0.858	Solute carrier family 2, facilitated glucose transporter member 4
4	9606.ENSP00000257940	0.837	Zinc finger CCCH domain-containing protein 10
5	9606.ENSP00000322218	0.752	Membrane-associated phosphatidylinositol transfer protein 2
6	9606.ENSP00000478059	0.743	Stromal interaction molecule 1
7	9606.ENSP00000368931	0.736	Coiled-coil domain containing 112
8	9606.ENSP00000362071	0.731	Junctophilin-2
9	9606.ENSP00000478637	0.730	Synaptotagmin-16
10	9606.ENSP00000355986	0.729	Synaptotagmin-14
11	9606.ENSP00000478933	0.705	Uncharacterized protein
12	9606.ENSP00000363441	0.704	Synaptotagmin-15
13	9606.ENSP00000348772	0.692	Membrane-associated phosphatidylinositol transfer protein 1
14	9606.ENSP00000255224	0.687	Synaptotagmin-4
15	9606.ENSP00000357307	0.687	Synaptotagmin-11
16	9606.ENSP00000417569	0.682	Stromal interaction molecule 2
17	9606.ENSP00000020926	0.661	Synaptotagmin-13
18	9606.ENSP00000359935	0.649	Fucose-1-phosphate guanylyltransferase
19	9606.ENSP00000454919	0.643	E3 ubiquitin-protein ligase that plays an important role in neuronal differentiation, including neurogenesis and gliogenesis, during brain development. During embryonic development initiates neuronal differentiation by inducing cell cycle arrest at the G0/G1 phase through up-regulation of cell-cycle regulatory proteins . Plays a role not only in the fetal period during the development of the nervous system, but also in the adult brain, where it is involved in the maintenance of neural functions and protection of the nervous tissue cells from oxidative stress-induced damage. Exhibits GT [...]
20	9606.ENSP00000338885	0.642	Phospholipid transfer protein C2CD2L

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008289	0.392	lipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0006810	0.980	transport
GO:0033036	0.925	macromolecule localization
GO:0010876	0.902	lipid localization
GO:0006869	0.876	lipid transport
GO:0071840	0.847	cellular component organization or biogenesis
GO:0061024	0.839	membrane organization
GO:0065007	0.694	biological regulation
GO:0050789	0.671	regulation of biological process
GO:0050794	0.373	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.980	membrane
GO:0031090	0.924	organelle membrane
GO:0005789	0.883	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]