StarFunc result for job id Q9BSK2

User Input

>input (321 residues)
MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTIS
GAGMVRPTSVTPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFN
GIFVPNSNIVHIFSAGSAAFITNSLMNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQT
EGIRGFYRGLTASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAA
ALSKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIRQIP
NTAIVLSTYELIVYLLEDRTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BSK2	1.000	1.000	2.056E-42	321	1.000	1.000	Q9BSK2.pdb.gz	S2533_HUMAN Solute carrier family 25 member 33 OS=Homo sapiens OX=9606 GN=SLC25A33 PE=1 SV=1
2	AFDB:Q922G0	0.844	0.870	3.890E-28	311	0.589	0.608	Q922G0.pdb.gz	S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus OX=10090 GN=Slc25a36 PE=2 SV=1
3	AFDB:Q9VQ37	0.876	0.772	7.293E-25	365	0.523	0.460	Q9VQ37.pdb.gz	RIM2_DROME Mitochondrial carrier protein Rim2 OS=Drosophila melanogaster OX=7227 GN=Rim2 PE=2 SV=2
4	AFDB:P38127	0.828	0.709	1.748E-19	377	0.352	0.300	P38127.pdb.gz	RIM2_YEAST Mitochondrial carrier protein RIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIM2 PE=1 SV=1
5	AFDB:Q59TD1	0.807	0.656	6.694E-19	399	0.380	0.306	Q59TD1.pdb.gz	Q59TD1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIM2 PE=3 SV=1
6	AFDB:P40556	0.799	0.693	1.264E-16	373	0.293	0.252	P40556.pdb.gz	YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YIA6 PE=1 SV=1
7	AFDB:O22261	0.779	0.800	3.278E-16	312	0.308	0.317	O22261.pdb.gz	NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NDT1 PE=1 SV=2
8	AFDB:Q8RWA5	0.791	0.703	3.898E-16	363	0.302	0.267	Q8RWA5.pdb.gz	NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDT2 PE=1 SV=1
9	AFDB:P39953	0.791	0.759	5.054E-16	335	0.280	0.269	P39953.pdb.gz	YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YEA6 PE=1 SV=1
10	AFDB:Q6IZB5	0.762	0.774	5.019E-15	316	0.271	0.275	Q6IZB5.pdb.gz	S2532_CRIGR Solute carrier family 25 member 32 OS=Cricetulus griseus OX=10029 GN=SLC25A32 PE=1 SV=1
11	PDB:4c9qB	0.725	0.796	3.049E-10	290	0.196	0.217	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.688	0.749	1.025E-9	293	0.187	0.205	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.508	0.548	5.436E-6	292	0.224	0.247	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:2lckA	0.514	0.546	7.579E-4	297	0.190	0.205	2lckA.pdb.gz
15	PDB:3qf4B	0.178	0.120	4.226E-1	588	0.143	0.078	3qf4B.pdb.gz	Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation
16	PDB:6ikoA	0.126	0.132	4.226E-1	303	0.106	0.112	6ikoA.pdb.gz
17	PDB:7p54A	0.128	0.108	7.106E-1	397	0.134	0.108	7p54A.pdb.gz
18	PDB:6wpwR	0.211	0.183	8.092E-1	398	0.090	0.073	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
19	PDB:6osaR	0.179	0.179	8.824E-1	321	0.115	0.115	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.
20	PDB:7ru6A	0.164	0.165	1.005	315	0.118	0.121	7ru6A.pdb.gz	Antiviral HIV-1 SERINC restriction factors disrupt virus membrane asymmetry.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TZX3	0.0	607	320	0.913	0.916	S2533_MOUSE Solute carrier family 25 member 33 OS=Mus musculus OX=10090 GN=Slc25a33 PE=2 SV=1
2	Q9BSK2	0.0	657	321	1.000	1.000	S2533_HUMAN Solute carrier family 25 member 33 OS=Homo sapiens OX=9606 GN=SLC25A33 PE=1 SV=1
3	Q922G0	4.05e-138	395	311	0.595	0.614	S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus OX=10090 GN=Slc25a36 PE=2 SV=1
4	Q96CQ1	2.53e-136	390	311	0.586	0.605	S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens OX=9606 GN=SLC25A36 PE=1 SV=1
5	M9ND06	9.39e-101	302	358	0.526	0.472	M9ND06_DROME Replication in mitochondria 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Rim2 PE=3 SV=1
6	Q9VQ37	2.11e-100	301	365	0.530	0.466	RIM2_DROME Mitochondrial carrier protein Rim2 OS=Drosophila melanogaster OX=7227 GN=Rim2 PE=2 SV=2
7	M9NDD0	9.25e-86	261	272	0.424	0.500	M9NDD0_DROME Replication in mitochondria 2, isoform D OS=Drosophila melanogaster OX=7227 GN=Rim2 PE=3 SV=1
8	Q59TD1	3.36e-71	228	399	0.396	0.318	Q59TD1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIM2 PE=3 SV=1
9	P38127	4.88e-53	180	377	0.346	0.294	RIM2_YEAST Mitochondrial carrier protein RIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIM2 PE=1 SV=1
10	Q8RWA5	3.75e-40	146	363	0.308	0.273	NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDT2 PE=1 SV=1
11	P39953	4.45e-40	145	335	0.271	0.260	YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YEA6 PE=1 SV=1
12	P40556	5.35e-40	145	373	0.302	0.260	YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YIA6 PE=1 SV=1
13	O22261	9.98e-38	138	312	0.287	0.295	NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NDT1 PE=1 SV=2
14	Q8BMG8	4.90e-28	112	316	0.271	0.275	S2532_MOUSE Solute carrier family 25 member 32 OS=Mus musculus OX=10090 GN=Slc25a32 PE=1 SV=1
15	Q7XA87	1.01e-27	111	308	0.302	0.315	FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FOLT1 PE=2 SV=1
16	Q9H2D1	1.33e-27	111	315	0.277	0.283	S2532_HUMAN Solute carrier family 25 member 32 OS=Homo sapiens OX=9606 GN=SLC25A32 PE=1 SV=2
17	Q9UTD6	1.67e-27	112	371	0.302	0.261	YID3_SCHPO Uncharacterized mitochondrial carrier C227.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC227.03c PE=3 SV=1
18	Q6IZB5	2.86e-27	110	316	0.274	0.278	S2532_CRIGR Solute carrier family 25 member 32 OS=Cricetulus griseus OX=10029 GN=SLC25A32 PE=1 SV=1
19	P40464	1.15e-26	108	311	0.259	0.267	FLX1_YEAST Mitochondrial FAD carrier protein FLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FLX1 PE=3 SV=1
20	Q57VA8	1.17e-26	108	310	0.255	0.265	Q57VA8_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.30H13.730 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	6.2e-62	216.9	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000011311

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000002040	0.715	RNA helicase
2	61853.ENSNLEP00000003534	0.640	DExD-box helicase 52
3	61853.ENSNLEP00000008598	0.640	Ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast)
4	61853.ENSNLEP00000008274	0.637	Solute carrier family 39 (zinc transporter), member 10
5	61853.ENSNLEP00000006188	0.636	Transporter
6	61853.ENSNLEP00000004324	0.631	Transporter
7	61853.ENSNLEP00000010903	0.627	Transducin (beta)-like 3
8	61853.ENSNLEP00000017040	0.621	Methyltransferase like 17
9	61853.ENSNLEP00000012425	0.617	Ribosomal L1 domain containing 1
10	61853.ENSNLEP00000004735	0.611	Pescadillo homolog
11	61853.ENSNLEP00000016346	0.610	Solute carrier family 19 (thiamine transporter), member 3
12	61853.ENSNLEP00000000015	0.606	NOC2 like nucleolar associated transcriptional repressor
13	61853.ENSNLEP00000002157	0.588	Phosphate transporter
14	61853.ENSNLEP00000014660	0.575	Major facilitator superfamily domain containing 2A
15	61853.ENSNLEP00000008326	0.572	Uncharacterized protein
16	61853.ENSNLEP00000008486	0.572	DEAD-box helicase 27
17	61853.ENSNLEP00000015267	0.536	T-complex protein 1 subunit gamma
18	61853.ENSNLEP00000021850	0.533	Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
19	61853.ENSNLEP00000000293	0.530	NOP14 nucleolar protein
20	61853.ENSNLEP00000005134	0.529	pre-rRNA processing protein FTSJ3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015215	1.000	nucleotide transmembrane transporter activity
GO:0008514	0.977	organic anion transmembrane transporter activity
GO:0005488	0.824	binding
GO:1901702	0.514	salt transmembrane transporter activity
GO:0005515	0.454	protein binding
GO:0005342	0.333	organic acid transmembrane transporter activity
GO:0046943	0.324	carboxylic acid transmembrane transporter activity
GO:0022804	0.315	active transmembrane transporter activity
GO:0015291	0.314	secondary active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0015931	0.994	nucleobase-containing compound transport
GO:0015748	0.984	organophosphate ester transport
GO:0065007	0.977	biological regulation
GO:0006862	0.953	nucleotide transport
GO:0050789	0.870	regulation of biological process
GO:0050794	0.770	regulation of cellular process
GO:0008152	0.627	metabolic process
GO:0071704	0.605	organic substance metabolic process
GO:0044237	0.558	cellular metabolic process
GO:0044238	0.459	primary metabolic process
GO:0071840	0.385	cellular component organization or biogenesis
GO:0006807	0.346	nitrogen compound metabolic process
GO:0055085	0.318	transmembrane transport
GO:0048518	0.308	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.983	membrane
GO:0031967	0.541	organelle envelope
GO:0031090	0.530	organelle membrane
GO:0070013	0.478	intracellular organelle lumen
GO:0031966	0.434	mitochondrial membrane
GO:0031981	0.409	nuclear lumen
GO:0043232	0.395	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]