StarFunc result for job id Q9BSK4

User Input

>input (669 residues)
MDLRTAVYNAARDGKLQLLQKLLSGRSREELDELTGEVAGGGTPLLIAARYGHLDVVEYL
VDRCGASVEAGGSVHFDGETIEGAPPLWAASAAGHLDVVRSLLRRGASVNRTTRTNSTPL
RAACFDGHLEVVRYLVGEHQADLEVANRHGHTCLMISCYKGHREIARYLLEQGAQVNRRS
AKGNTALHDCAESGSLEILQLLLGCKARMERDGYGMTPLLAASVTGHTNIVEYLIQEQPG
QEQVAGGEAQPGLPQEDPSTSQGCAQPQGAPCCSSSPEEPLNGESYESCCPTSREAAVEA
LELLGATYVDKKRDLLGALKHWRRAMELRHQGGEYLPKPEPPQLVLAYDYSREVNTTEEL
EALITDPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFERCIRLWKYALDMQ
QSNLEPLSPMTASSFLSFAELFSYVLQDRAAKGSLGTQIGFADLMGVLTKGVREVERALQ
LPREPGDSAQFTKALAIILHLLYLLEKVECTPSQEHLKHQTVYRLLKCAPRGKNGFTPLH
MAVDKDTTNVGRYPVGRFPSLHVVKVLLDCGADPDSRDFDNNTPLHIAAQNNCPAIMNAL
IEAGAHMDATNAFKKTAYELLDEKLLARGTMQPFNYVTLQCLAARALDKNKIPYKGFIPE
DLEAFIELH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BSK4	1.000	1.000	1.658E-88	669	1.000	1.000	Q9BSK4.pdb.gz	FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens OX=9606 GN=FEM1A PE=1 SV=1
2	AFDB:Q96JP0	0.901	0.975	8.066E-62	617	0.644	0.699	Q96JP0.pdb.gz	FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens OX=9606 GN=FEM1C PE=1 SV=1
3	AFDB:Q9UK73	0.821	0.873	1.524E-40	627	0.362	0.386	Q9UK73.pdb.gz	FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens OX=9606 GN=FEM1B PE=1 SV=1
4	AFDB:P17221	0.790	0.804	1.983E-33	656	0.327	0.334	P17221.pdb.gz	FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans OX=6239 GN=fem-1 PE=1 SV=1
5	AFDB:P97582	0.310	0.255	2.307E-17	843	0.214	0.170	P97582.pdb.gz	P97582_RAT Ankyrin (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
6	AFDB:Q9NCP8	0.351	0.210	1.840E-16	1159	0.199	0.115	Q9NCP8.pdb.gz	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
7	AFDB:Q3UES3	0.196	0.114	2.809E-16	1166	0.187	0.107	Q3UES3.pdb.gz	TNKS2_MOUSE Poly [ADP-ribose] polymerase tankyrase-2 OS=Mus musculus OX=10090 GN=Tnks2 PE=2 SV=2
8	PDB:8cs9A	0.202	0.175	2.831E-16	796	0.236	0.198	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
9	AFDB:O95271	0.192	0.112	1.585E-15	1327	0.191	0.096	O95271.pdb.gz	TNKS1_HUMAN Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=2
10	AFDB:Q9VBP3	0.183	0.105	1.849E-15	1181	0.199	0.113	Q9VBP3.pdb.gz	TNKS_DROME Poly [ADP-ribose] polymerase tankyrase OS=Drosophila melanogaster OX=7227 GN=Tnks PE=1 SV=1
11	AFDB:P16157	0.353	0.138	1.921E-15	1881	0.202	0.072	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
12	PDB:5vkqA	0.344	0.160	1.514E-10	1499	0.166	0.074	5vkqA.pdb.gz
13	PDB:2dvwA	0.290	0.818	1.261E-8	229	0.087	0.253	2dvwA.pdb.gz
14	PDB:4oauC	0.341	0.332	2.160E-8	692	0.175	0.169	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:1wg0A	0.286	0.761	2.733E-7	243	0.067	0.185	1wg0A.pdb.gz
16	PDB:6v9hC	0.269	0.637	4.356E-6	270	0.090	0.222	6v9hC.pdb.gz
17	PDB:6pqpA	0.233	0.251	8.376E-6	615	0.136	0.148	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
18	PDB:6dmwA	0.242	0.254	1.491E-5	631	0.142	0.151	6dmwA.pdb.gz	Structural insights on TRPV5 gating by endogenous modulators.
19	PDB:6aunA	0.212	0.226	2.366E-5	618	0.085	0.092	6aunA.pdb.gz
20	PDB:6v9xA	0.260	0.301	2.555E-5	571	0.108	0.126	6v9xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96JP0	0.0	610	617	0.510	0.553	FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens OX=9606 GN=FEM1C PE=1 SV=1
2	Q9BSK4	0.0	1380	669	1.000	1.000	FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens OX=9606 GN=FEM1A PE=1 SV=1
3	Q9Z2G1	0.0	1190	654	0.895	0.916	FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus OX=10090 GN=Fem1aa PE=1 SV=1
4	Q9UK73	3.21e-124	384	627	0.368	0.392	FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens OX=9606 GN=FEM1B PE=1 SV=1
5	Q9Z2G0	5.48e-124	383	627	0.368	0.392	FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus OX=10090 GN=Fem1b PE=1 SV=1
6	P17221	2.60e-94	306	656	0.335	0.341	FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans OX=6239 GN=fem-1 PE=1 SV=1
7	Q9ULJ7	3.25e-28	124	1429	0.130	0.061	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
8	Q9VMR4	3.89e-24	110	1761	0.130	0.049	Q9VMR4_DROME No mechanoreceptor potential C, isoform H OS=Drosophila melanogaster OX=7227 GN=nompC PE=4 SV=4
9	Q7KTN8	3.91e-24	110	1735	0.130	0.050	Q7KTN8_DROME No mechanoreceptor potential C, isoform F OS=Drosophila melanogaster OX=7227 GN=nompC PE=4 SV=2
10	E0A9E1	4.01e-24	110	1732	0.130	0.050	E0A9E1_DROME No mechanoreceptor potential C isoform L OS=Drosophila melanogaster OX=7227 GN=nompC PE=1 SV=1
11	A0A0S0WN65	4.17e-24	110	1755	0.130	0.050	A0A0S0WN65_DROME No mechanoreceptor potential C, isoform G OS=Drosophila melanogaster OX=7227 GN=nompC PE=4 SV=1
12	A8DYV6	4.18e-24	110	1726	0.130	0.050	A8DYV6_DROME No mechanoreceptor potential C, isoform D OS=Drosophila melanogaster OX=7227 GN=nompC PE=4 SV=2
13	Q7KIQ2	4.95e-24	110	1619	0.130	0.054	Q7KIQ2_DROME Mechanosensory transduction channel NOMPC OS=Drosophila melanogaster OX=7227 GN=nompC PE=2 SV=1
14	Q9VCA8	1.07e-23	109	4001	0.103	0.017	ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster OX=7227 GN=mask PE=1 SV=2
15	Q99NH0	4.59e-22	104	2603	0.121	0.031	ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus OX=10090 GN=Ankrd17 PE=1 SV=2
16	Q9EQG6	4.88e-22	104	1762	0.121	0.046	KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus OX=10116 GN=Kidins220 PE=1 SV=2
17	H0YM23	5.10e-22	104	2487	0.121	0.033	H0YM23_HUMAN Ankyrin repeat domain 17 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=1
18	O75179	5.37e-22	104	2603	0.121	0.031	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
19	F1M5N3	5.67e-22	104	3966	0.114	0.019	F1M5N3_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4
20	A0A5F9ZI46	8.34e-22	103	3882	0.114	0.020	A0A5F9ZI46_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	4.8e-37	136.1	Ankyrin repeat
2	PF12796 Ank_2	3.9e-59	208.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	3.5e-34	123.8	Ankyrin repeat
4	PF13637 Ank_4	2.6e-34	128.4	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2.2e-32	121.9	Ankyrin repeats (many copies)
6	PF13374 TPR_10	3.6e+02	12.5	Tetratricopeptide repeat
7	PF13424 TPR_12	0.026	26.1	Tetratricopeptide repeat
8	PF07719 TPR_2	38	15.8	Tetratricopeptide repeat
9	PF10787 YfmQ	5.9e+02	11.5	Uncharacterised protein from bacillus cereus group

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269856

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302846	0.921	Prostaglandin E2 receptor EP4 subtype
2	9606.ENSP00000444856	0.896	Cullin-2
3	9606.ENSP00000263212	0.851	Protein phosphatase 1F
4	9606.ENSP00000262306	0.797	Elongin-B
5	9606.ENSP00000312411	0.745	Protein phosphatase 1E
6	9606.ENSP00000417706	0.741	DCN1-like protein 2
7	9606.ENSP00000478121	0.730	Elongin-C
8	9606.ENSP00000216225	0.665	E3 ubiquitin-protein ligase RBX1
9	9606.ENSP00000250495	0.645	NEDD8
10	9606.ENSP00000292782	0.640	DCN1-like protein 1
11	9606.ENSP00000335203	0.607	ATPase inhibitor, mitochondrial
12	9606.ENSP00000260247	0.605	DCN1-like protein 5
13	9606.ENSP00000389900	0.605	DCN1-like protein 4
14	9606.ENSP00000263401	0.600	COMM domain-containing protein 9
15	9606.ENSP00000267935	0.600	COMM domain-containing protein 4
16	9606.ENSP00000274458	0.600	COMM domain-containing protein 10
17	9606.ENSP00000278980	0.600	COMM domain-containing protein 7
18	9606.ENSP00000308236	0.600	COMM domain-containing protein 1
19	9606.ENSP00000348054	0.600	COMM domain containing 6
20	9606.ENSP00000365401	0.600	Coiled-coil domain-containing protein 22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990756	1.000	ubiquitin ligase-substrate adaptor activity
GO:0005102	0.995	signaling receptor binding
GO:0001664	0.890	G protein-coupled receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0071704	0.980	organic substance metabolic process
GO:0044237	0.979	cellular metabolic process
GO:0044238	0.972	primary metabolic process
GO:0050727	0.971	regulation of inflammatory response
GO:0048519	0.969	negative regulation of biological process
GO:0006807	0.961	nitrogen compound metabolic process
GO:0050794	0.957	regulation of cellular process
GO:0019222	0.940	regulation of metabolic process
GO:0043170	0.914	macromolecule metabolic process
GO:0048523	0.902	negative regulation of cellular process
GO:0048585	0.870	negative regulation of response to stimulus
GO:0043161	0.847	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0060255	0.839	regulation of macromolecule metabolic process
GO:0080090	0.837	regulation of primary metabolic process
GO:0051171	0.829	regulation of nitrogen compound metabolic process
GO:0031348	0.811	negative regulation of defense response
GO:0032102	0.787	negative regulation of response to external stimulus
GO:0031323	0.731	regulation of cellular metabolic process
GO:0023051	0.712	regulation of signaling
GO:0051246	0.674	regulation of protein metabolic process
GO:0010646	0.648	regulation of cell communication
GO:0050728	0.642	negative regulation of inflammatory response
GO:0048518	0.479	positive regulation of biological process
GO:0010605	0.455	negative regulation of macromolecule metabolic process
GO:0031399	0.429	regulation of protein modification process
GO:0065009	0.422	regulation of molecular function
GO:0031324	0.355	negative regulation of cellular metabolic process
GO:0051172	0.352	negative regulation of nitrogen compound metabolic process
GO:0050896	0.332	response to stimulus
GO:0044092	0.318	negative regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0032991	0.982	protein-containing complex
GO:0005829	0.979	cytosol
GO:0070013	0.941	intracellular organelle lumen
GO:0005654	0.933	nucleoplasm
GO:0005739	0.899	mitochondrion
GO:0000151	0.771	ubiquitin ligase complex
GO:0031461	0.705	cullin-RING ubiquitin ligase complex
GO:0031462	0.531	Cul2-RING ubiquitin ligase complex
GO:0016020	0.409	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]