StarFunc result for job id Q9BSM1

User Input

>input (259 residues)
MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTI
TECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEE
KRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGK
DKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSR
WFGKPSPLLLQYSVKEKRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R023	0.549	0.549	3.406E-48	259	0.981	0.981	Q8R023.pdb.gz	PCGF1_MOUSE Polycomb group RING finger protein 1 OS=Mus musculus OX=10090 GN=Pcgf1 PE=2 SV=2
2	AFDB:Q7ZYZ7	0.674	0.670	1.632E-43	261	0.780	0.774	Q7ZYZ7.pdb.gz	PCGF1_DANRE Polycomb group RING finger protein 1 OS=Danio rerio OX=7955 GN=pcgf1 PE=3 SV=1
3	AFDB:Q3KNV8	0.428	0.456	5.768E-27	242	0.359	0.384	Q3KNV8.pdb.gz	PCGF3_HUMAN Polycomb group RING finger protein 3 OS=Homo sapiens OX=9606 GN=PCGF3 PE=1 SV=1
4	AFDB:Q3UK78	0.424	0.428	8.591E-25	256	0.290	0.293	Q3UK78.pdb.gz	PCGF5_MOUSE Polycomb group RING finger protein 5 OS=Mus musculus OX=10090 GN=Pcgf5 PE=1 SV=1
5	AFDB:Q99NA9	0.450	0.360	3.141E-22	353	0.317	0.232	Q99NA9.pdb.gz	PCGF6_MOUSE Polycomb group RING finger protein 6 OS=Mus musculus OX=10090 GN=Pcgf6 PE=1 SV=1
6	AFDB:A0A024R1V6	0.407	0.311	3.349E-22	344	0.324	0.244	A0A024R1V6.pdb.gz
7	AFDB:Q7T3E6	0.414	0.334	3.808E-22	324	0.332	0.265	Q7T3E6.pdb.gz	BMI1B_DANRE Polycomb complex protein BMI-1-B OS=Danio rerio OX=7955 GN=bmi1b PE=2 SV=1
8	AFDB:R4GMX3	0.399	0.235	4.329E-22	469	0.347	0.192	R4GMX3.pdb.gz	R4GMX3_HUMAN COMMD3-BMI1 readthrough OS=Homo sapiens OX=9606 GN=COMMD3-BMI1 PE=4 SV=1
9	AFDB:Q9BYE7	0.400	0.300	1.063E-21	350	0.344	0.254	Q9BYE7.pdb.gz	PCGF6_HUMAN Polycomb group RING finger protein 6 OS=Homo sapiens OX=9606 GN=PCGF6 PE=1 SV=2
10	AFDB:Q8JIR0	0.415	0.340	4.955E-21	320	0.324	0.263	Q8JIR0.pdb.gz	BMI1A_DANRE Polycomb complex protein BMI-1-A OS=Danio rerio OX=7955 GN=bmi1a PE=1 SV=2
11	PDB:4r8pL	0.305	0.310	3.668E-6	254	0.093	0.094	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
12	PDB:6aafA	0.289	0.628	1.823E-5	112	0.081	0.188	6aafA.pdb.gz	Lipidation-independent vacuolar functions of Atg8 rely on its noncanonical interaction with a vacuole membrane protein
13	PDB:7yo8A	0.304	0.543	2.679E-5	140	0.085	0.157	7yo8A.pdb.gz
14	PDB:7lswC	0.299	0.513	3.463E-5	145	0.081	0.145	7lswC.pdb.gz
15	PDB:5l83B	0.289	0.627	3.692E-5	112	0.081	0.188	5l83B.pdb.gz	Structural Basis of Host Autophagy-related Protein 8 (ATG8) Binding by the Irish Potato Famine Pathogen Effector Protein PexRD54.
16	PDB:7aa8C	0.285	0.527	4.476E-5	133	0.081	0.158	7aa8C.pdb.gz
17	PDB:5yipA	0.278	0.557	4.773E-5	123	0.081	0.171	5yipA.pdb.gz	Potent and specific Atg8-targeting autophagy inhibitory peptides from giant ankyrins.
18	PDB:6yvaC	0.263	0.422	6.169E-5	155	0.050	0.084	6yvaC.pdb.gz
19	PDB:6mdhA	0.250	0.415	6.577E-5	149	0.058	0.101	6mdhA.pdb.gz
20	PDB:7bruA	0.283	0.514	6.577E-5	138	0.093	0.174	7bruA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R023	0.0	532	259	0.981	0.981	PCGF1_MOUSE Polycomb group RING finger protein 1 OS=Mus musculus OX=10090 GN=Pcgf1 PE=2 SV=2
2	Q9BSM1	0.0	539	259	1.000	1.000	PCGF1_HUMAN Polycomb group RING finger protein 1 OS=Homo sapiens OX=9606 GN=PCGF1 PE=1 SV=2
3	Q6DLV9	1.01e-175	485	243	0.903	0.963	PCGF1_RAT Polycomb group RING finger protein 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Pcgf1 PE=2 SV=1
4	Q7ZYZ7	4.20e-155	433	261	0.780	0.774	PCGF1_DANRE Polycomb group RING finger protein 1 OS=Danio rerio OX=7955 GN=pcgf1 PE=3 SV=1
5	Q8BTQ0	9.10e-54	176	241	0.371	0.398	PCGF3_MOUSE Polycomb group RING finger protein 3 OS=Mus musculus OX=10090 GN=PcgF3 PE=1 SV=1
6	Q3KNV8	2.62e-53	174	242	0.375	0.401	PCGF3_HUMAN Polycomb group RING finger protein 3 OS=Homo sapiens OX=9606 GN=PCGF3 PE=1 SV=1
7	P35226	5.05e-50	169	326	0.355	0.282	BMI1_HUMAN Polycomb complex protein BMI-1 OS=Homo sapiens OX=9606 GN=BMI1 PE=1 SV=2
8	P25916	1.23e-49	167	324	0.359	0.287	BMI1_MOUSE Polycomb complex protein BMI-1 OS=Mus musculus OX=10090 GN=Bmi1 PE=1 SV=1
9	Q7T3E6	4.81e-49	166	324	0.340	0.272	BMI1B_DANRE Polycomb complex protein BMI-1-B OS=Danio rerio OX=7955 GN=bmi1b PE=2 SV=1
10	Q8JIR0	8.26e-49	165	320	0.340	0.275	BMI1A_DANRE Polycomb complex protein BMI-1-A OS=Danio rerio OX=7955 GN=bmi1a PE=1 SV=2
11	R4GMX3	9.52e-49	169	469	0.355	0.196	R4GMX3_HUMAN COMMD3-BMI1 readthrough OS=Homo sapiens OX=9606 GN=COMMD3-BMI1 PE=4 SV=1
12	P35227	1.12e-48	166	344	0.340	0.256	PCGF2_HUMAN Polycomb group RING finger protein 2 OS=Homo sapiens OX=9606 GN=PCGF2 PE=1 SV=1
13	P23798	9.77e-48	163	342	0.336	0.254	PCGF2_MOUSE Polycomb group RING finger protein 2 OS=Mus musculus OX=10090 GN=Pcgf2 PE=1 SV=2
14	Q99NA9	2.38e-44	154	353	0.320	0.235	PCGF6_MOUSE Polycomb group RING finger protein 6 OS=Mus musculus OX=10090 GN=Pcgf6 PE=1 SV=1
15	Q9BYE7	1.45e-43	152	350	0.313	0.231	PCGF6_HUMAN Polycomb group RING finger protein 6 OS=Homo sapiens OX=9606 GN=PCGF6 PE=1 SV=2
16	Q3UK78	9.91e-37	132	256	0.293	0.297	PCGF5_MOUSE Polycomb group RING finger protein 5 OS=Mus musculus OX=10090 GN=Pcgf5 PE=1 SV=1
17	Q86SE9	2.32e-36	131	256	0.286	0.289	PCGF5_HUMAN Polycomb group RING finger protein 5 OS=Homo sapiens OX=9606 GN=PCGF5 PE=1 SV=1
18	P35820	3.17e-30	121	1601	0.278	0.045	PSC_DROME Polycomb group protein Psc OS=Drosophila melanogaster OX=7227 GN=Psc PE=1 SV=2
19	P25172	6.62e-23	99.8	1368	0.243	0.046	SUZ2_DROME Protein suppressor 2 of zeste OS=Drosophila melanogaster OX=7227 GN=Su(z)2 PE=2 SV=2
20	Q5T8Z2	7.41e-22	91.7	184	0.135	0.190	Q5T8Z2_HUMAN BMI1 proto-oncogene, polycomb ring finger (Fragment) OS=Homo sapiens OX=9606 GN=BMI1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02991 ATG8	50	15.5	Autophagy protein Atg8 ubiquitin like
2	PF09469 Cobl	81	15.0	Cordon-bleu ubiquitin-like domain
3	PF11976 Rad60-SLD	4.3	18.6	Ubiquitin-2 like Rad60 SUMO-like
4	PF16207 RAWUL	1.5e-11	56.0	RAWUL domain RING finger- and WD40-associated ubiquitin-like
5	PF12861 zf-ANAPC11	1e+02	14.4	Anaphase-promoting complex subunit 11 RING-H2 finger
6	PF00097 zf-C3HC4	3.4e-05	34.9	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	6.5e-06	37.2	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	0.067	24.4	Zinc finger, C3HC4 type (RING finger)
9	PF15227 zf-C3HC4_4	3.8e+02	12.6	zinc finger of C3HC4-type, RING
10	PF11789 zf-Nse	52	15.2	Zinc-finger of the MIZ type in Nse subunit
11	PF12678 zf-rbx1	0.085	24.5	RING-H2 zinc finger domain
12	PF13639 zf-RING_2	0.014	27.0	Ring finger domain
13	PF14634 zf-RING_5	0.26	22.6	zinc-RING finger domain
14	PF13445 zf-RING_UBOX	7.6	18.0	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000233630

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356480	0.999	E3 ubiquitin-protein ligase RING2
2	9606.ENSP00000363787	0.999	E3 ubiquitin-protein ligase RING1
3	9606.ENSP00000366271	0.999	Lysine-specific demethylase 2B
4	9606.ENSP00000367705	0.999	BCL-6 corepressor
5	9606.ENSP00000419494	0.997	RING1 and YY1-binding protein
6	9606.ENSP00000437775	0.993	BCL-6 corepressor-like protein 1
7	9606.ENSP00000216133	0.992	Chromobox protein homolog 7
8	9606.ENSP00000269385	0.990	Chromobox protein homolog 8
9	9606.ENSP00000269397	0.980	E3 SUMO-protein ligase CBX4
10	9606.ENSP00000231487	0.979	S-phase kinase-associated protein 1
11	9606.ENSP00000308750	0.978	Chromobox protein homolog 2
12	9606.ENSP00000384490	0.977	Chromobox protein homolog 6
13	9606.ENSP00000440674	0.975	Polyhomeotic-like protein 1
14	9606.ENSP00000257118	0.972	Polyhomeotic-like protein 2
15	9606.ENSP00000316578	0.968	Polycomb protein SUZ12
16	9606.ENSP00000320147	0.963	Histone-lysine N-methyltransferase EZH2
17	9606.ENSP00000420294	0.961	Polyhomeotic-like protein 3
18	9606.ENSP00000263360	0.960	Polycomb protein EED
19	9606.ENSP00000381840	0.954	Zinc finger protein AEBP2
20	9606.ENSP00000404658	0.952	Histone-lysine N-methyltransferase EZH1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140096	0.513	catalytic activity, acting on a protein
GO:0016740	0.318	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.978	regulation of metabolic process
GO:0008152	0.970	metabolic process
GO:0071704	0.951	organic substance metabolic process
GO:0044238	0.947	primary metabolic process
GO:0060255	0.938	regulation of macromolecule metabolic process
GO:0050794	0.933	regulation of cellular process
GO:0006807	0.927	nitrogen compound metabolic process
GO:0043170	0.922	macromolecule metabolic process
GO:0009987	0.894	cellular process
GO:0080090	0.872	regulation of primary metabolic process
GO:0051171	0.871	regulation of nitrogen compound metabolic process
GO:0019538	0.866	protein metabolic process
GO:0031323	0.830	regulation of cellular metabolic process
GO:0010468	0.829	regulation of gene expression
GO:0019219	0.792	regulation of nucleobase-containing compound metabolic process
GO:0016570	0.776	histone modification
GO:0009889	0.775	regulation of biosynthetic process
GO:0010556	0.770	regulation of macromolecule biosynthetic process
GO:0031326	0.769	regulation of cellular biosynthetic process
GO:0051252	0.726	regulation of RNA metabolic process
GO:2001141	0.722	regulation of RNA biosynthetic process
GO:0006355	0.714	regulation of DNA-templated transcription
GO:0071840	0.654	cellular component organization or biogenesis
GO:0016567	0.650	protein ubiquitination
GO:0016043	0.612	cellular component organization
GO:0016574	0.517	histone ubiquitination
GO:0006513	0.503	protein monoubiquitination
GO:0048519	0.350	negative regulation of biological process
GO:0006325	0.330	chromatin organization
GO:0048523	0.312	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031519	1.000	PcG protein complex
GO:0005654	0.999	nucleoplasm
GO:1902494	0.454	catalytic complex
GO:0005737	0.445	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.318	Transferases.

[back to server]