StarFunc result for job id Q9BST9

User Input

>input (563 residues)
MFSRNHRSRVTVARGSALEMEFKRGRFRLSLFSDLPEDTELQRKLDHEIRMREGACKLLA
ACSQREQALEATKSLLVCNSRILSYMGELQRRKEAQVLGKTSRRPSDSGPPAERSPCRGR
VCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLGEHIQDTEMILVDRTLTDISFQSNV
LFAEAGPDFELRLELYGACVEEEGALTGGPKRLATKLSSSLGRSSGRRVRASLDSAGGSG
SSPILLPTPVVGGPRYHLLAHTTLTLAAVQDGFRTHDLTLASHEENPAWLPLYGSVCCRL
AAQPLCMTQPTASGTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEEPLLTIAV
NKETRVRAGELDQALGRPFTLSISNQYGDDEVTHTLQTESREALQSWMEALWQLFFDMSQ
WKQCCDEIMKIETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPP
PWLAMFTDQPALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPP
QRSPRTRGLCSKGQPRTWLQSPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BST9	1.000	1.000	4.257E-103	563	1.000	1.000	Q9BST9.pdb.gz	RTKN_HUMAN Rhotekin OS=Homo sapiens OX=9606 GN=RTKN PE=1 SV=2
2	AFDB:Q8C6B2	0.811	0.809	1.348E-89	564	0.869	0.867	Q8C6B2.pdb.gz	RTKN_MOUSE Rhotekin OS=Mus musculus OX=10090 GN=Rtkn PE=1 SV=3
3	AFDB:Q8IZC4	0.638	0.591	1.784E-53	609	0.384	0.355	Q8IZC4.pdb.gz	RTKN2_HUMAN Rhotekin-2 OS=Homo sapiens OX=9606 GN=RTKN2 PE=2 SV=1
4	AFDB:Q14B46	0.638	0.596	2.967E-52	604	0.368	0.343	Q14B46.pdb.gz	RTKN2_MOUSE Rhotekin-2 OS=Mus musculus OX=10090 GN=Rtkn2 PE=1 SV=2
5	AFDB:A0A024RA49	0.447	0.244	7.788E-23	1124	0.149	0.075	A0A024RA49.pdb.gz
6	AFDB:Q8K298	0.452	0.248	1.988E-22	1121	0.155	0.078	Q8K298.pdb.gz	ANLN_MOUSE Anillin OS=Mus musculus OX=10090 GN=Anln PE=1 SV=2
7	AFDB:Q1LUB2	0.453	0.253	8.804E-22	1089	0.147	0.076	Q1LUB2.pdb.gz
8	AFDB:A0A286Y917	0.457	0.240	2.651E-21	1171	0.162	0.078	A0A286Y917.pdb.gz	A0A286Y917_DANRE Anillin isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-197n10.2 PE=1 SV=1
9	AFDB:P49796	0.148	0.075	1.183E-6	1198	0.149	0.070	P49796.pdb.gz	RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2
10	AFDB:Q9HAU0	0.165	0.086	2.859E-6	1116	0.085	0.043	Q9HAU0.pdb.gz	PKHA5_HUMAN Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
11	PDB:5iz5B	0.166	0.130	1.955E-5	746	0.053	0.040	5iz5B.pdb.gz
12	PDB:5iz5A	0.166	0.127	3.585E-5	757	0.046	0.034	5iz5A.pdb.gz
13	PDB:5ixcA	0.166	0.139	3.788E-5	684	0.046	0.038	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:3pfqA	0.126	0.133	7.756E-5	523	0.069	0.075	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
15	PDB:5izrC	0.166	0.144	1.205E-4	659	0.052	0.044	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:3nsjA	0.173	0.183	1.588E-4	530	0.044	0.047	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
17	PDB:1cjyA	0.167	0.151	1.873E-4	633	0.032	0.028	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
18	PDB:3ljuX	0.158	0.232	1.980E-4	373	0.025	0.038	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
19	PDB:6bbpA	0.148	0.159	2.755E-4	520	0.044	0.048	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
20	PDB:4rj9A	0.105	0.332	4.525E-4	161	0.025	0.087	4rj9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C6B2	0.0	975	564	0.869	0.867	RTKN_MOUSE Rhotekin OS=Mus musculus OX=10090 GN=Rtkn PE=1 SV=3
2	Q9BST9	0.0	1155	563	1.000	1.000	RTKN_HUMAN Rhotekin OS=Homo sapiens OX=9606 GN=RTKN PE=1 SV=2
3	Q8IZC4	6.38e-135	407	609	0.350	0.323	RTKN2_HUMAN Rhotekin-2 OS=Homo sapiens OX=9606 GN=RTKN2 PE=2 SV=1
4	Q14B46	1.11e-124	380	604	0.373	0.348	RTKN2_MOUSE Rhotekin-2 OS=Mus musculus OX=10090 GN=Rtkn2 PE=1 SV=2
5	Q8K298	5.46e-06	52.0	1121	0.163	0.082	ANLN_MOUSE Anillin OS=Mus musculus OX=10090 GN=Anln PE=1 SV=2
6	Q9V4P1	0.066	38.9	1239	0.062	0.028	ANLN_DROME Anillin OS=Drosophila melanogaster OX=7227 GN=scra PE=1 SV=3
7	F1QJH8	0.28	36.6	1153	0.162	0.079	F1QJH8_DANRE Anillin OS=Danio rerio OX=7955 GN=si:ch211-197n10.2 PE=1 SV=1
8	Q8BGF9	0.52	35.4	314	0.044	0.080	S2544_MOUSE Solute carrier family 25 member 44 OS=Mus musculus OX=10090 GN=Slc25a44 PE=1 SV=1
9	A0A286Y917	0.68	35.4	1171	0.167	0.080	A0A286Y917_DANRE Anillin isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-197n10.2 PE=1 SV=1
10	Q10665	2.5	33.5	754	0.053	0.040	MES3_CAEEL Polycomb protein mes-3 OS=Caenorhabditis elegans OX=6239 GN=mes-3 PE=1 SV=2
11	G8JY65	2.6	33.5	735	0.053	0.041	G8JY65_CAEEL Polycomb protein mes-3 OS=Caenorhabditis elegans OX=6239 GN=mes-3 PE=1 SV=2
12	Q810E9	2.6	33.1	442	0.067	0.086	Q810E9_MOUSE Factor in the germline beta OS=Mus musculus OX=10090 GN=Tcfl5 PE=2 SV=1
13	Q5DTT2	4.5	32.7	1024	0.050	0.027	PSD1_MOUSE PH and SEC7 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Psd PE=1 SV=2
14	Q9ESQ7	4.7	32.7	649	0.050	0.043	PSD1_RAT PH and SEC7 domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Psd PE=1 SV=1
15	Q9VIV8	8.0	31.6	454	0.032	0.040	Q9VIV8_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG13084 PE=4 SV=1
16	M9PC48	8.9	32.0	18095	0.030	0.001	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PCJ6	8.9	32.0	18641	0.030	0.001	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	Q9Y2U5	8.9	31.6	619	0.052	0.047	M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2
19	Q3V133	9.4	31.2	279	0.066	0.133	Q3V133_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Tcfl5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08174 Anillin	4e-37	139.2	Cell division protein anillin
2	PF02185 HR1	0.6	21.5	Hr1 repeat
3	PF00169 PH	0.00027	32.8	PH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272430

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.999	Transforming protein RhoA
2	9606.ENSP00000357705	0.988	S100 calcium binding protein A4
3	9606.ENSP00000221459	0.983	Protein lin-7 homolog B
4	9606.ENSP00000285735	0.959	Rho-related GTP-binding protein RhoC
5	9606.ENSP00000225525	0.954	Tax1-binding protein 3
6	9606.ENSP00000295256	0.936	Hematopoietic prostaglandin D synthase
7	9606.ENSP00000272233	0.868	Rho-related GTP-binding protein RhoB
8	9606.ENSP00000240123	0.851	Vinexin
9	9606.ENSP00000383118	0.848	Cell division control protein 42 homolog
10	9606.ENSP00000380942	0.799	Rho guanine nucleotide exchange factor 12
11	9606.ENSP00000447488	0.797	Protein lin-7 homolog A
12	9606.ENSP00000357484	0.795	Golgi-associated PDZ and coiled-coil motif-containing protein
13	9606.ENSP00000289013	0.790	Rhophilin-1
14	9606.ENSP00000402000	0.731	Septin-4
15	9606.ENSP00000391249	0.699	Septin-9
16	9606.ENSP00000211314	0.654	Transmembrane protein 14A
17	9606.ENSP00000348461	0.654	Ras-related C3 botulinum toxin substrate 1
18	9606.ENSP00000264893	0.645	Septin-11
19	9606.ENSP00000296271	0.644	Rhodopsin
20	9606.ENSP00000357177	0.643	Rho guanine nucleotide exchange factor 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	1.000	small GTPase binding
GO:0005095	1.000	GTPase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0043067	0.993	regulation of programmed cell death
GO:0035556	0.988	intracellular signal transduction
GO:0042981	0.969	regulation of apoptotic process
GO:0007265	0.960	Ras protein signal transduction
GO:0007266	0.951	Rho protein signal transduction
GO:0048518	0.554	positive regulation of biological process
GO:0048522	0.518	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005886	0.365	plasma membrane
GO:0043226	0.356	organelle
GO:0043229	0.344	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]