StarFunc result for job id Q9BSU1

User Input

>input (422 residues)
MLDLEVVPERSLGNEQWEFTLGMPLAQAVAILQKHCRIIKNVQVLYSEQSPLSHDLILNL
TQDGIKLMFDAFNQRLKVIEVCDLTKVKLKYCGVHFNSQAIAPTIEQIDQSFGATHPGVY
NSAEQLFHLNFRGLSFSFQLDSWTEAPKYEPNFAHGLASLQIPHGATVKRMYIYSGNSLQ
DTKAPMMPLSCFLGNVYAESVDVLRDGTGPAGLRLRLLAAGCGPGLLADAKMRVFERSVY
FGDSCQDVLSMLGSPHKVFYKSEDKMKIHSPSPHKQVPSKCNDYFFNYFTLGVDILFDAN
THKVKKFVLHTNYPGHYNFNIYHRCEFKIPLAIKKENADGQTETCTTYSKWDNIQELLGH
PVEKPVVLHRSSSPNNTNPFGSTFCFGLQRMIFEVMQNNHIASVTLYGPPRPGSHLRTAE
LP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08654	0.976	0.976	1.424E-84	422	0.976	0.976	O08654.pdb.gz	PHAF1_RAT Phagosome assembly factor 1 OS=Rattus norvegicus OX=10116 GN=Phaf1 PE=2 SV=1
2	AFDB:P34692	0.880	0.880	2.352E-45	422	0.346	0.346	P34692.pdb.gz	PHAF1_CAEEL PHAF1 protein T01G9.2 OS=Caenorhabditis elegans OX=6239 GN=T01G9.2 PE=1 SV=3
3	AFDB:Q55AH8	0.732	0.599	1.373E-37	519	0.353	0.287	Q55AH8.pdb.gz	Q55AH8_DICDI UPF0183 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271880 PE=3 SV=1
4	AFDB:Q9SD33	0.781	0.803	3.530E-37	410	0.308	0.317	Q9SD33.pdb.gz	PHAF1_ARATH PHAF1 protein At3g51130 OS=Arabidopsis thaliana OX=3702 GN=At3g51130 PE=1 SV=2
5	AFDB:Q9VRX2	0.106	0.056	8.711E-5	1229	0.097	0.033	Q9VRX2.pdb.gz	VPS8_DROME Vacuolar protein sorting-associated protein 8 homolog OS=Drosophila melanogaster OX=7227 GN=Vps8 PE=1 SV=1
6	AFDB:Q59Y20	0.101	0.074	8.976E-4	724	0.123	0.072	Q59Y20.pdb.gz	DSE1_CANAL Protein DSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DSE1 PE=3 SV=1
7	PDB:6lqsB1	0.090	0.057	1.323E-3	806	0.123	0.065	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
8	AFDB:P25635	0.102	0.058	1.324E-3	923	0.104	0.048	P25635.pdb.gz	PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PWP2 PE=1 SV=2
9	AFDB:Q9VHN9	0.131	0.084	1.480E-3	826	0.102	0.052	Q9VHN9.pdb.gz	HPS5_DROME BLOC-2 complex member HPS5 homolog OS=Drosophila melanogaster OX=7227 GN=p PE=2 SV=1
10	AFDB:Q5A852	0.104	0.052	2.183E-3	922	0.085	0.039	Q5A852.pdb.gz	Q5A852_CANAL SnoRNA-binding rRNA-processing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PWP2 PE=3 SV=1
11	AFDB:Q4Q127	0.091	0.091	2.726E-3	419	0.100	0.100	Q4Q127.pdb.gz	Q4Q127_LEIMA Eukaryotic translation initiation factor 3 subunit I OS=Leishmania major OX=5664 GN=LMJF_36_3880 PE=3 SV=1
12	PDB:7mq8LN	0.109	0.079	4.745E-3	671	0.102	0.064	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:1gjqA	0.110	0.097	5.016E-3	541	0.095	0.074	1gjqA.pdb.gz	Cyanide Binding to Cd(1) Nitrite Reductase from Pseudomonas Aeruginosa: Role of the Active-Site His369 in Ligand Stabilization.
14	PDB:7ajtUA	0.121	0.076	5.016E-3	834	0.092	0.047	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:8dysA	0.108	0.110	5.303E-3	409	0.111	0.115	8dysA.pdb.gz
16	PDB:7q3eA	0.133	0.108	5.606E-3	551	0.092	0.071	7q3eA.pdb.gz	Structure of the ciliogenesis-associated CPLANE complex.
17	PDB:7mqaLO	0.110	0.071	5.926E-3	819	0.118	0.061	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7r5jT0	0.120	0.074	8.741E-3	1004	0.135	0.057	7r5jT0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:7mq8LR	0.096	0.063	9.240E-3	773	0.085	0.047	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6nd4Q	0.099	0.061	9.768E-3	862	0.104	0.051	6nd4Q.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08654	0.0	868	422	0.976	0.976	PHAF1_RAT Phagosome assembly factor 1 OS=Rattus norvegicus OX=10116 GN=Phaf1 PE=2 SV=1
2	Q9BSU1	0.0	885	422	1.000	1.000	PHAF1_HUMAN Phagosome assembly factor 1 OS=Homo sapiens OX=9606 GN=PHAF1 PE=1 SV=1
3	P34692	4.30e-83	263	422	0.355	0.355	PHAF1_CAEEL PHAF1 protein T01G9.2 OS=Caenorhabditis elegans OX=6239 GN=T01G9.2 PE=1 SV=3
4	Q9SD33	5.56e-68	223	410	0.325	0.334	PHAF1_ARATH PHAF1 protein At3g51130 OS=Arabidopsis thaliana OX=3702 GN=At3g51130 PE=1 SV=2
5	Q55AH8	1.74e-57	198	519	0.287	0.233	Q55AH8_DICDI UPF0183 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271880 PE=3 SV=1
6	H2KYW5	0.73	34.3	294	0.057	0.082	NSY7_CAEEL Transcription factor nsy-7 OS=Caenorhabditis elegans OX=6239 GN=nsy-7 PE=1 SV=1
7	Q6DE09	3.0	32.7	771	0.050	0.027	Q6DE09_XENLA Eif4enif1-prov protein OS=Xenopus laevis OX=8355 GN=eif4enif1.S PE=2 SV=1
8	Q61329	4.0	32.3	3726	0.064	0.007	ZFHX3_MOUSE Zinc finger homeobox protein 3 OS=Mus musculus OX=10090 GN=Zfhx3 PE=1 SV=1
9	F1M4Q6	4.2	32.3	3730	0.064	0.007	F1M4Q6_RAT Zinc finger homeobox 3 OS=Rattus norvegicus OX=10116 GN=Zfhx3 PE=4 SV=3
10	Q15911	4.8	32.3	3703	0.064	0.007	ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens OX=9606 GN=ZFHX3 PE=1 SV=2
11	Q80UL1	8.2	29.6	124	0.052	0.177	Q80UL1_RAT Myomesin 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Myom1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03676 PHAF1	1.1e-157	537.1	Phagosome assembly factor 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219139

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000375067	0.884	Breast carcinoma-amplified sequence 3
2	9606.ENSP00000247986	0.706	Kinesin-like protein KIF17
3	9606.ENSP00000355022	0.662	Uncharacterized protein C16orf59
4	9606.ENSP00000366384	0.662	Zinc finger protein 311
5	9606.ENSP00000385527	0.651	Major facilitator superfamily domain-containing protein 2B
6	9606.ENSP00000332162	0.642	Steroid receptor-associated and regulated protein
7	9606.ENSP00000367408	0.642	Peripheral plasma membrane protein CASK
8	9606.ENSP00000308873	0.630	Coiled-coil domain containing 74B
9	9606.ENSP00000276211	0.603	Rho GTPase-activating protein 36
10	9606.ENSP00000415151	0.579	Core-binding factor subunit beta
11	9606.ENSP00000346483	0.561	DDRGK domain-containing protein 1
12	9606.ENSP00000361952	0.560	Potassium channel subfamily K member 15
13	9606.ENSP00000265381	0.555	Amyloid-beta A4 precursor protein-binding family A member 1
14	9606.ENSP00000341412	0.529	Placenta-expressed transcript 1 protein
15	9606.ENSP00000335808	0.508	Protein FAM192A
16	9606.ENSP00000289528	0.502	Zinc finger AN1-type containing 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030165	0.922	PDZ domain binding
GO:0035254	0.921	glutamate receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0033036	0.985	macromolecule localization
GO:0008104	0.984	protein localization
GO:0071702	0.978	organic substance transport
GO:0015031	0.963	protein transport
GO:0072657	0.917	protein localization to membrane
GO:0072659	0.884	protein localization to plasma membrane
GO:0090150	0.884	establishment of protein localization to membrane
GO:0006893	0.851	Golgi to plasma membrane transport
GO:0061951	0.851	establishment of protein localization to plasma membrane
GO:0043001	0.770	Golgi to plasma membrane protein transport
GO:0050789	0.480	regulation of biological process
GO:0050794	0.461	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.997	endomembrane system
GO:0043229	0.996	intracellular organelle
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0016020	0.992	membrane
GO:0030054	0.924	cell junction
GO:0031090	0.774	organelle membrane
GO:0120025	0.724	plasma membrane bounded cell projection
GO:0031410	0.715	cytoplasmic vesicle
GO:0031984	0.714	organelle subcompartment
GO:0045202	0.698	synapse
GO:0005794	0.688	Golgi apparatus
GO:0098588	0.619	bounding membrane of organelle
GO:0000407	0.574	phagophore assembly site
GO:0098793	0.544	presynapse
GO:0005634	0.509	nucleus
GO:0043005	0.496	neuron projection
GO:0030659	0.477	cytoplasmic vesicle membrane
GO:0099503	0.476	secretory vesicle
GO:0030133	0.468	transport vesicle
GO:0071944	0.467	cell periphery
GO:0005886	0.446	plasma membrane
GO:0098791	0.446	Golgi apparatus subcompartment
GO:0005802	0.427	trans-Golgi network
GO:0008021	0.421	synaptic vesicle
GO:0036477	0.413	somatodendritic compartment
GO:0030425	0.394	dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]