StarFunc result for job id Q9BSU3

User Input

>input (229 residues)
MNIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWPQLSYIAEDEDGKIVGYVLAKM
EEEPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRPALH
LYSNTLNFQISEVEPKYYADGEDAYAMKRDLSQMADELRRQMDLKKGGYVVLGSRENQET
QGSTLSDSEEACQQKNPATEESGSDSKEPKESVESTNVQDSSESSDSTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BSU3	1.000	1.000	1.053E-44	229	1.000	1.000	Q9BSU3.pdb.gz	NAA11_HUMAN N-alpha-acetyltransferase 11 OS=Homo sapiens OX=9606 GN=NAA11 PE=1 SV=3
2	AFDB:P41227	0.753	0.735	4.028E-37	235	0.821	0.800	P41227.pdb.gz	NAA10_HUMAN N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10 PE=1 SV=1
3	AFDB:Q7T3B8	0.695	0.710	2.883E-36	224	0.742	0.759	Q7T3B8.pdb.gz	Q7T3B8_DANRE N-terminal amino-acid N(alpha)-acetyltransferase NatA OS=Danio rerio OX=7955 GN=ard1a PE=1 SV=1
4	PDB:6c95B	0.684	0.969	6.002E-32	161	0.664	0.944	6c95B.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
5	AFDB:Q9VT75	0.719	0.838	8.307E-31	196	0.563	0.658	Q9VT75.pdb.gz	Q9VT75_DROME N-terminal amino-acid N(alpha)-acetyltransferase NatA OS=Drosophila melanogaster OX=7227 GN=vnc PE=1 SV=1
6	AFDB:O61219	0.678	0.851	3.301E-29	182	0.528	0.665	O61219.pdb.gz	DAF31_CAEEL N-alpha-acetyltransferase daf-31 OS=Caenorhabditis elegans OX=6239 GN=daf-31 PE=2 SV=1
7	AFDB:Q9UTI3	0.660	0.853	1.772E-26	177	0.454	0.588	Q9UTI3.pdb.gz	ARD1_SCHPO N-terminal acetyltransferase A complex catalytic subunit ard1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ard1 PE=1 SV=1
8	AFDB:Q9FKI4	0.651	0.776	1.440E-25	192	0.454	0.542	Q9FKI4.pdb.gz	NAA10_ARATH N-terminal acetyltransferase A complex catalytic subunit NAA10 OS=Arabidopsis thaliana OX=3702 GN=NAA10 PE=1 SV=1
9	AFDB:Q385W4	0.651	0.624	2.847E-24	239	0.419	0.402	Q385W4.pdb.gz	Q385W4_TRYB2 N-acetyltransferase subunit ARD1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2110 PE=3 SV=1
10	AFDB:P07347	0.636	0.612	2.003E-22	238	0.402	0.387	P07347.pdb.gz	ARD1_YEAST N-terminal acetyltransferase A complex catalytic subunit ARD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARD1 PE=1 SV=2
11	AFDB:Q6P4J0	0.498	0.865	4.028E-22	131	0.472	0.824	Q6P4J0.pdb.gz	Q6P4J0_HUMAN N-terminal amino-acid N(alpha)-acetyltransferase NatA OS=Homo sapiens OX=9606 GN=ARD1A PE=1 SV=1
12	PDB:4hnxB	0.590	0.632	6.314E-20	213	0.389	0.418	4hnxB.pdb.gz	The Protein Complex NatA Binds Inositol Hexakisphosphate and Exhibits Conformational Flexibility
13	PDB:6hd5u	0.622	0.606	1.191E-19	235	0.410	0.400	6hd5u.pdb.gz
14	PDB:5c88A	0.621	0.892	1.308E-17	158	0.253	0.367	5c88A.pdb.gz	Multiple Conformations of the Loop Region Confers Heat-Resistance on SsArd1, a Thermophilic NatA.
15	PDB:6ygbA	0.605	0.855	6.784E-13	159	0.170	0.245	6ygbA.pdb.gz	Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.
16	PDB:7stxA	0.598	0.848	9.319E-13	158	0.231	0.335	7stxA.pdb.gz	Cryo-EM structure of human NatB in complex with CoA-Alpha-Synuclein
17	PDB:7l1kA	0.606	0.916	1.549E-12	149	0.170	0.262	7l1kA.pdb.gz	Molecular mechanism of N-terminal acetylation by the ternary NatC complex.
18	PDB:2ob0C	0.596	0.808	7.934E-11	166	0.148	0.205	2ob0C.pdb.gz	Structure of Human MAK3 homolog
19	PDB:5isvA	0.564	0.807	1.237E-10	156	0.148	0.218	5isvA.pdb.gz
20	PDB:5hgzA	0.570	0.615	1.319E-10	211	0.153	0.166	5hgzA.pdb.gz	Structure and function of human Naa60 (NatF), a Golgi-localized bi-functional acetyltransferase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BSU3	1.08e-173	478	229	1.000	1.000	NAA11_HUMAN N-alpha-acetyltransferase 11 OS=Homo sapiens OX=9606 GN=NAA11 PE=1 SV=3
2	P41227	4.08e-131	370	235	0.799	0.779	NAA10_HUMAN N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10 PE=1 SV=1
3	Q9QY36	5.80e-131	370	235	0.795	0.774	NAA10_MOUSE N-alpha-acetyltransferase 10 OS=Mus musculus OX=10090 GN=Naa10 PE=1 SV=1
4	Q7T3B8	1.71e-117	335	224	0.742	0.759	Q7T3B8_DANRE N-terminal amino-acid N(alpha)-acetyltransferase NatA OS=Danio rerio OX=7955 GN=ard1a PE=1 SV=1
5	Q9VT75	7.27e-91	267	196	0.550	0.643	Q9VT75_DROME N-terminal amino-acid N(alpha)-acetyltransferase NatA OS=Drosophila melanogaster OX=7227 GN=vnc PE=1 SV=1
6	O61219	1.82e-88	261	182	0.515	0.648	DAF31_CAEEL N-alpha-acetyltransferase daf-31 OS=Caenorhabditis elegans OX=6239 GN=daf-31 PE=2 SV=1
7	Q6P4J0	1.32e-79	236	131	0.472	0.824	Q6P4J0_HUMAN N-terminal amino-acid N(alpha)-acetyltransferase NatA OS=Homo sapiens OX=9606 GN=ARD1A PE=1 SV=1
8	Q9UTI3	6.17e-73	221	177	0.441	0.571	ARD1_SCHPO N-terminal acetyltransferase A complex catalytic subunit ard1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ard1 PE=1 SV=1
9	Q9FKI4	2.35e-71	218	192	0.441	0.526	NAA10_ARATH N-terminal acetyltransferase A complex catalytic subunit NAA10 OS=Arabidopsis thaliana OX=3702 GN=NAA10 PE=1 SV=1
10	Q9NFL8	4.73e-61	193	239	0.393	0.377	Q9NFL8_9TRYP Putative N-acetyltransferase subunit ARD1 OS=Trypanosoma brucei OX=5691 GN=ARD1 PE=3 SV=1
11	Q385W4	5.10e-61	193	239	0.393	0.377	Q385W4_TRYB2 N-acetyltransferase subunit ARD1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2110 PE=3 SV=1
12	P07347	2.30e-50	166	238	0.397	0.382	ARD1_YEAST N-terminal acetyltransferase A complex catalytic subunit ARD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARD1 PE=1 SV=2
13	Q980R9	8.27e-28	105	167	0.262	0.359	NAT_SACS2 N-alpha-acetyltransferase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=ard1 PE=1 SV=2
14	M9PI14	2.59e-23	94.4	180	0.275	0.350	M9PI14_DROME N(Alpha)-acetyltransferase 20 A, isoform B OS=Drosophila melanogaster OX=7227 GN=Naa20A PE=4 SV=1
15	P61599	3.91e-20	85.9	178	0.236	0.303	NAA20_HUMAN N-alpha-acetyltransferase 20 OS=Homo sapiens OX=9606 GN=NAA20 PE=1 SV=1
16	A8MZB2	1.82e-19	84.0	166	0.231	0.319	A8MZB2_HUMAN N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae), isoform CRA_a OS=Homo sapiens OX=9606 GN=NAA20 PE=1 SV=1
17	O74457	1.05e-15	74.3	180	0.210	0.267	NAT3_SCHPO N-terminal acetyltransferase B complex catalytic subunit naa20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=naa20 PE=3 SV=1
18	Q06504	6.89e-13	67.0	195	0.218	0.256	NAT3_YEAST N-terminal acetyltransferase B complex catalytic subunit NAT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAT3 PE=1 SV=2
19	O16486	5.08e-12	65.9	278	0.192	0.158	O16486_CAEEL N-acetyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=natc-2 PE=1 SV=1
20	O80438	5.55e-12	64.3	190	0.192	0.232	MAK3_ARATH N-alpha-acetyltransferase MAK3 OS=Arabidopsis thaliana OX=3702 GN=MAK3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00583 Acetyltransf_1	7.7e-12	56.9	Acetyltransferase (GNAT) family
2	PF13673 Acetyltransf_10	3.2e-06	38.5	Acetyltransferase (GNAT) domain
3	PF13880 Acetyltransf_13	14	16.9	ESCO1/2 acetyl-transferase
4	PF17013 Acetyltransf_15	11	17.0	Putative acetyl-transferase
5	PF13302 Acetyltransf_3	32	16.6	Acetyltransferase (GNAT) domain
6	PF13508 Acetyltransf_7	0.00011	33.7	Acetyltransferase (GNAT) domain
7	PF13527 Acetyltransf_9	2.7	19.5	Acetyltransferase (GNAT) domain
8	PF08445 FR47	0.00014	33.1	FR47-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286794

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296543	0.996	N-alpha-acetyltransferase 15, NatA auxiliary subunit
2	9606.ENSP00000368716	0.996	N-alpha-acetyltransferase 16, NatA auxiliary subunit
3	9606.ENSP00000240922	0.985	N-alpha-acetyltransferase 50
4	9606.ENSP00000354972	0.980	N-alpha-acetyltransferase 35, NatC auxiliary subunit
5	9606.ENSP00000452521	0.928	N-alpha-acetyltransferase 30
6	9606.ENSP00000332103	0.917	N-alpha-acetyltransferase 38, NatC auxiliary subunit
7	9606.ENSP00000385903	0.903	N-alpha-acetyltransferase 60
8	9606.ENSP00000417763	0.902	N-alpha-acetyltransferase 10
9	9606.ENSP00000261745	0.901	N-alpha-acetyltransferase 25, NatB auxiliary subunit
10	9606.ENSP00000367024	0.772	N-alpha-acetyltransferase 40
11	9606.ENSP00000263381	0.723	Protein Wiz
12	9606.ENSP00000392318	0.704	Cysteine-rich protein 2-binding protein
13	9606.ENSP00000389103	0.696	60S ribosomal protein L23a
14	9606.ENSP00000335636	0.637	N-alpha-acetyltransferase 20
15	9606.ENSP00000384474	0.596	Huntingtin-interacting protein K
16	9606.ENSP00000364591	0.572	Testis-specific Y-encoded-like protein 2
17	9606.ENSP00000055335	0.557	Protein phosphatase 1 regulatory subunit 3F
18	9606.ENSP00000325312	0.549	Methionine aminopeptidase 2
19	9606.ENSP00000428085	0.521	Ribosomal protein L30
20	9606.ENSP00000298283	0.509	60S ribosomal protein L10-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004596	1.000	peptide alpha-N-acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019538	0.998	protein metabolic process
GO:0010467	0.997	gene expression
GO:0043412	0.995	macromolecule modification
GO:0043543	0.993	protein acylation
GO:0006473	0.975	protein acetylation
GO:0051604	0.972	protein maturation
GO:0031365	0.957	N-terminal protein amino acid modification
GO:0009987	0.754	cellular process
GO:0065007	0.497	biological regulation
GO:0050794	0.405	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0031248	0.998	protein acetyltransferase complex
GO:0070013	0.995	intracellular organelle lumen
GO:0031414	0.994	N-terminal protein acetyltransferase complex
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0031981	0.988	nuclear lumen
GO:0016020	0.746	membrane
GO:0031415	0.508	NatA complex
GO:0005654	0.404	nucleoplasm
GO:0005730	0.379	nucleolus
GO:0012505	0.348	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.

[back to server]