StarFunc result for job id Q9BSW2

User Input

>input (731 residues)
MAAPDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQ
TCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQ
NNPSQEDAGEQVAQRHEEKVYLSRGDEDLGDMGEDEEAQFRMLMDRLGAQKVLEDESDVK
QLWLQLKKEEPHLLSNFEDFLTRIISQLQEAHEEKNELECALKRKIAAYDEEIQHLYEEM
EQQIKSEKEQFLLKDTERFQARSQELEQKLLCKEQELEQLTQKQKRLEGQCTALHHDKHE
TKAENTKLKLTNQELARELERTSWELQDAQQQLESLQQEACKLHQEKEMEVYRVTESLQR
EKAGLLKQLDFLRERNKHLRDERDICFQKNKAAKANTAASRASWKKRSGSVIGKYVDSRG
ILRSQSEEEEEVFGIPRRSSLGLSGYPLTEEEPGTGEPGPGGPYPRPLRRIISVEEDPLP
QLLDGGFEQPLSKCSEEEEVSDQGVQGQIPEAPPLKLTPTSPRGQPVGKEALCKEESSPS
APDRLFKIVFVGNSAVGKTSFLRRFCEDRFSPGMAATVGIDYRVKTLNVDNSQVALQLWD
TAGQERYRCITQQFFRKADGVIVMYDLTDKQSFLSVRRWLSSVEEAVGDRVPVLLLGNKL
DNEKEREVPRGLGEQLATENNLIFYECSAYSGHNTKESLLHLARFLKEQEDTVREDTIQV
GHPAKKKSCCG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BSW2	1.000	1.000	0.000	731	1.000	1.000	Q9BSW2.pdb.gz	EFC4B_HUMAN EF-hand calcium-binding domain-containing protein 4B OS=Homo sapiens OX=9606 GN=CRACR2A PE=1 SV=2
2	AFDB:Q3UP38	0.452	0.454	3.935E-89	726	0.804	0.810	Q3UP38.pdb.gz	EFC4B_MOUSE EF-hand calcium-binding domain-containing protein 4B OS=Mus musculus OX=10090 GN=Cracr2a PE=2 SV=2
3	AFDB:Q8IZ41	0.249	0.246	3.220E-41	740	0.272	0.269	Q8IZ41.pdb.gz	RASEF_HUMAN Ras and EF-hand domain-containing protein OS=Homo sapiens OX=9606 GN=RASEF PE=1 SV=1
4	AFDB:Q7Z6P3	0.263	0.197	5.955E-39	1021	0.335	0.240	Q7Z6P3.pdb.gz	RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens OX=9606 GN=RAB44 PE=1 SV=4
5	AFDB:Q8CB87	0.272	0.214	1.980E-36	973	0.328	0.247	Q8CB87.pdb.gz	RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus OX=10090 GN=Rab44 PE=1 SV=2
6	AFDB:P17609	0.248	0.869	7.469E-23	200	0.112	0.410	P17609.pdb.gz	YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ypt2 PE=3 SV=1
7	AFDB:P0CY31	0.249	0.826	8.398E-23	210	0.100	0.348	P0CY31.pdb.gz	SEC4_CANAL Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SEC4 PE=1 SV=1
8	AFDB:G5EFC1	0.255	0.867	1.062E-22	211	0.100	0.346	G5EFC1.pdb.gz	G5EFC1_CAEEL Rab8 OS=Caenorhabditis elegans OX=6239 GN=rab-8 PE=1 SV=1
9	AFDB:P38555	0.251	0.807	1.194E-22	223	0.090	0.296	P38555.pdb.gz	YPT31_YEAST GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPT31 PE=1 SV=3
10	AFDB:A4FVK4	0.251	0.859	1.343E-22	207	0.103	0.362	A4FVK4.pdb.gz	A4FVK4_DANRE RAB8A, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8 PE=1 SV=1
11	PDB:1zbdA	0.235	0.949	8.476E-21	177	0.103	0.424	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
12	PDB:5sziA	0.234	0.962	1.011E-20	174	0.094	0.397	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
13	PDB:5szjA	0.231	0.947	5.872E-20	175	0.093	0.389	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
14	PDB:2ew1A	0.230	0.957	2.544E-19	171	0.093	0.398	2ew1A.pdb.gz	Crystal structure of RAB30 in complex with a GTP analogue
15	PDB:8a4cB	0.229	0.966	2.544E-19	170	0.098	0.424	8a4cB.pdb.gz	Rep15 interacts with several Rab GTPases and has a distinct fold for a Rab effector.
16	PDB:5szhB	0.230	0.937	3.034E-19	175	0.083	0.349	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
17	PDB:2zetA	0.230	0.897	4.574E-19	181	0.094	0.381	2zetA.pdb.gz	Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.
18	PDB:6if2B	0.233	0.928	1.567E-18	178	0.083	0.343	6if2B.pdb.gz	Rab35/ACAP2 and Rab35/RUSC2 Complex Structures Reveal Molecular Basis for Effector Recognition by Rab35 GTPase.
19	PDB:2f9mA	0.245	0.955	3.563E-18	182	0.079	0.319	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
20	PDB:6y7gB	0.216	0.914	5.696E-18	165	0.090	0.400	6y7gB.pdb.gz	Structure of the human RAB3C in complex with GDP

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UP38	0.0	1135	726	0.804	0.810	EFC4B_MOUSE EF-hand calcium-binding domain-containing protein 4B OS=Mus musculus OX=10090 GN=Cracr2a PE=2 SV=2
2	Q9BSW2	0.0	1495	731	1.000	1.000	EFC4B_HUMAN EF-hand calcium-binding domain-containing protein 4B OS=Homo sapiens OX=9606 GN=CRACR2A PE=1 SV=2
3	Q8IZ41	4.34e-62	223	740	0.283	0.280	RASEF_HUMAN Ras and EF-hand domain-containing protein OS=Homo sapiens OX=9606 GN=RASEF PE=1 SV=1
4	Q8CB87	1.31e-56	211	973	0.135	0.102	RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus OX=10090 GN=Rab44 PE=1 SV=2
5	Q7Z6P3	4.68e-56	209	1021	0.134	0.096	RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens OX=9606 GN=RAB44 PE=1 SV=4
6	P17609	5.69e-45	161	200	0.109	0.400	YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ypt2 PE=3 SV=1
7	P20791	1.41e-44	160	203	0.103	0.369	RAB8B_DICDI Ras-related protein Rab-8B OS=Dictyostelium discoideum OX=44689 GN=rab8B PE=2 SV=1
8	P20790	1.07e-43	158	208	0.103	0.361	RAB8A_DICDI Ras-related protein Rab-8A OS=Dictyostelium discoideum OX=44689 GN=rab8A PE=3 SV=1
9	O42819	1.81e-43	158	215	0.101	0.344	SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SEC4 PE=3 SV=1
10	G5EFC1	1.93e-43	157	211	0.098	0.341	G5EFC1_CAEEL Rab8 OS=Caenorhabditis elegans OX=6239 GN=rab-8 PE=1 SV=1
11	P07560	2.30e-43	157	215	0.100	0.340	SEC4_YEAST Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC4 PE=1 SV=1
12	Q8K386	2.60e-43	157	212	0.094	0.325	RAB15_MOUSE Ras-related protein Rab-15 OS=Mus musculus OX=10090 GN=Rab15 PE=1 SV=1
13	P35289	5.76e-43	156	212	0.094	0.325	RAB15_RAT Ras-related protein Rab-15 OS=Rattus norvegicus OX=10116 GN=Rab15 PE=2 SV=1
14	A4FVK4	7.63e-43	156	207	0.098	0.348	A4FVK4_DANRE RAB8A, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8 PE=1 SV=1
15	P20336	9.25e-43	156	220	0.108	0.359	RAB3A_HUMAN Ras-related protein Rab-3A OS=Homo sapiens OX=9606 GN=RAB3A PE=1 SV=1
16	P11023	9.34e-43	156	220	0.108	0.359	RAB3A_BOVIN Ras-related protein Rab-3A OS=Bos taurus OX=9913 GN=RAB3A PE=1 SV=3
17	Q7T3A4	1.03e-42	155	200	0.101	0.370	RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio OX=7955 GN=rab13 PE=1 SV=1
18	Q4W9I4	1.04e-42	155	206	0.104	0.369	Q4W9I4_ASPFU Rab GTPase SrgA, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G04810 PE=4 SV=1
19	P59190	1.26e-42	155	212	0.094	0.325	RAB15_HUMAN Ras-related protein Rab-15 OS=Homo sapiens OX=9606 GN=RAB15 PE=1 SV=1
20	P63011	1.35e-42	155	220	0.108	0.359	RAB3A_MOUSE Ras-related protein Rab-3A OS=Mus musculus OX=10090 GN=Rab3a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13671 AAA_33	1e+02	14.5	AAA domain
2	PF00025 Arf	4.3e-13	60.6	ADP-ribosylation factor family
3	PF19220 Crescentin	1.4e+02	12.9	Crescentin protein
4	PF00036 EF-hand_1	0.00016	32.0	EF hand
5	PF13202 EF-hand_5	0.055	24.2	EF hand
6	PF13405 EF-hand_6	0.00011	32.7	EF-hand domain
7	PF13499 EF-hand_7	1.6e-07	43.0	EF-hand domain pair
8	PF13833 EF-hand_8	0.27	22.4	EF-hand domain pair
9	PF00009 GTP_EFTU	7.5e+02	11.0	Elongation factor Tu GTP binding domain
10	PF04670 Gtr1_RagA	25	15.7	Gtr1/RagA G protein conserved region
11	PF01926 MMR_HSR1	0.001	30.5	50S ribosome-binding GTPase
12	PF04665 Pox_A32	7.7e+02	10.9	Poxvirus A32 protein
13	PF00071 Ras	1e-45	166.7	Ras family
14	PF08477 Roc	1.4e-27	107.7	Ras of Complex, Roc, domain of DAPkinase
15	PF03193 RsgA_GTPase	1.7e+02	13.5	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000409382

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480616	0.972	Calcium release-activated calcium channel protein 1
2	9606.ENSP00000478059	0.863	Stromal interaction molecule 1
3	9606.ENSP00000261726	0.788	Homeobox protein cut-like 2
4	9606.ENSP00000337632	0.788	SAP domain-containing ribonucleoprotein
5	9606.ENSP00000353401	0.788	Homeobox protein cut-like 1
6	9606.ENSP00000447000	0.788	Uncharacterized protein
7	9606.ENSP00000348752	0.738	Protein orai-2
8	9606.ENSP00000273130	0.711	Cytoplasmic dynein 1 light intermediate chain 1
9	9606.ENSP00000256255	0.681	Store-operated calcium entry-associated regulatory factor
10	9606.ENSP00000322249	0.677	Protein orai-3
11	9606.ENSP00000347195	0.660	TMEM110-MUSTN1 readthrough
12	9606.ENSP00000422941	0.660	annotation not available
13	9606.ENSP00000368767	0.655	Aspartyl/asparaginyl beta-hydroxylase
14	9606.ENSP00000312356	0.549	tRNA methyltransferase 10 homolog C
15	9606.ENSP00000374274	0.541	Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D
16	9606.ENSP00000258198	0.537	Cytoplasmic dynein 1 light intermediate chain 2
17	9606.ENSP00000397925	0.536	Calcium-transporting ATPase type 2C member 2
18	9606.ENSP00000410964	0.527	Erlin-1
19	9606.ENSP00000334642	0.515	PDZ domain-containing protein 8
20	9606.ENSP00000381949	0.506	Collagen alpha-1(XIII) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043167	0.999	ion binding
GO:0005515	0.999	protein binding
GO:0003924	0.995	GTPase activity
GO:0043169	0.967	cation binding
GO:0005509	0.961	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0001775	0.985	cell activation
GO:0002250	0.985	adaptive immune response
GO:0050794	0.984	regulation of cellular process
GO:0042110	0.983	T cell activation
GO:0002366	0.983	leukocyte activation involved in immune response
GO:0009966	0.964	regulation of signal transduction
GO:0002285	0.945	lymphocyte activation involved in immune response
GO:0002292	0.944	T cell differentiation involved in immune response
GO:0046631	0.941	alpha-beta T cell activation
GO:0046632	0.918	alpha-beta T cell differentiation
GO:0070302	0.904	regulation of stress-activated protein kinase signaling cascade
GO:0048518	0.884	positive regulation of biological process
GO:0002460	0.877	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0048522	0.862	positive regulation of cellular process
GO:0035710	0.857	CD4-positive, alpha-beta T cell activation
GO:0051179	0.854	localization
GO:0070304	0.847	positive regulation of stress-activated protein kinase signaling cascade
GO:0046328	0.846	regulation of JNK cascade
GO:0051234	0.723	establishment of localization
GO:0006810	0.707	transport
GO:0002287	0.511	alpha-beta T cell activation involved in immune response
GO:0051049	0.501	regulation of transport
GO:0046330	0.499	positive regulation of JNK cascade
GO:0043367	0.481	CD4-positive, alpha-beta T cell differentiation
GO:0043269	0.353	regulation of monoatomic ion transport
GO:0051641	0.339	cellular localization
GO:0051649	0.303	establishment of localization in cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.998	membrane
GO:0012505	0.998	endomembrane system
GO:0031410	0.987	cytoplasmic vesicle
GO:0070013	0.975	intracellular organelle lumen
GO:0005829	0.955	cytosol
GO:0071944	0.939	cell periphery
GO:0005576	0.932	extracellular region
GO:0005886	0.930	plasma membrane
GO:0043232	0.908	intracellular non-membrane-bounded organelle
GO:0031090	0.856	organelle membrane
GO:0099503	0.759	secretory vesicle
GO:0005634	0.741	nucleus
GO:0005794	0.716	Golgi apparatus
GO:0032991	0.708	protein-containing complex
GO:0098588	0.651	bounding membrane of organelle
GO:0005615	0.606	extracellular space
GO:1903561	0.560	extracellular vesicle
GO:0070062	0.508	extracellular exosome
GO:0031981	0.500	nuclear lumen
GO:0005654	0.492	nucleoplasm
GO:0030141	0.451	secretory granule
GO:0031984	0.409	organelle subcompartment
GO:0005856	0.393	cytoskeleton
GO:0042581	0.312	specific granule
GO:0012506	0.307	vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.995	GTP + H2O = GDP + H(+) + phosphate

[back to server]