StarFunc result for job id Q9BSW7

User Input

>input (474 residues)
MAYIQLEPLNEGFLSRISGLLLCRWTCRHCCQKCYESSCCQSSEDEVEILGPFPAQTPPW
LMASRSSDKDGDSVHTASEVPLTPRTNSPDGRRSSSDTSKSTYSLTRRISSLESRRPSSP
LIDIKPIEFGVLSAKKEPIQPSVLRRTYNPDDYFRKFEPHLYSLDSNSDDVDSLTDEEIL
SKYQLGMLHFSTQYDLLHNHLTVRVIEARDLPPPISHDGSRQDMAHSNPYVKICLLPDQK
NSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEV
DLVKGGHWWKALIPSSQNEVELGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPF
VKIQLVHGLKLVKTKKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSND
FIGRIVIGQYSSGPSETNHWRRMLNTHRTAVEQWHSLRSRAECDRVSPASLEVT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BSW7	1.000	1.000	3.692E-87	474	1.000	1.000	Q9BSW7.pdb.gz	SYT17_HUMAN Synaptotagmin-17 OS=Homo sapiens OX=9606 GN=SYT17 PE=1 SV=1
2	AFDB:O43581	0.377	0.427	3.472E-35	403	0.291	0.342	O43581.pdb.gz	SYT7_HUMAN Synaptotagmin-7 OS=Homo sapiens OX=9606 GN=SYT7 PE=1 SV=3
3	AFDB:Q86SS6	0.317	0.307	1.259E-34	491	0.281	0.271	Q86SS6.pdb.gz	SYT9_HUMAN Synaptotagmin-9 OS=Homo sapiens OX=9606 GN=SYT9 PE=1 SV=1
4	AFDB:Q62746	0.330	0.308	1.647E-34	511	0.283	0.262	Q62746.pdb.gz	SYT6_RAT Synaptotagmin-6 OS=Rattus norvegicus OX=10116 GN=Syt6 PE=1 SV=1
5	AFDB:D4P8S0	0.388	0.380	1.834E-34	488	0.293	0.285	D4P8S0.pdb.gz	D4P8S0_DANRE Synaptotagmin VIIb OS=Danio rerio OX=7955 GN=syt7 PE=2 SV=1
6	AFDB:P29101	0.321	0.358	2.399E-34	422	0.245	0.275	P29101.pdb.gz	SYT2_RAT Synaptotagmin-2 OS=Rattus norvegicus OX=10116 GN=Syt2 PE=1 SV=1
7	AFDB:P21521	0.325	0.325	5.087E-34	474	0.268	0.268	P21521.pdb.gz	SY65_DROME Synaptotagmin 1 OS=Drosophila melanogaster OX=7227 GN=Syt1 PE=1 SV=3
8	AFDB:Q95QH7	0.297	0.318	5.976E-34	443	0.243	0.260	Q95QH7.pdb.gz	Q95QH7_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=snt-1 PE=1 SV=1
9	AFDB:P21579	0.324	0.362	8.702E-34	422	0.268	0.301	P21579.pdb.gz	SYT1_HUMAN Synaptotagmin-1 OS=Homo sapiens OX=9606 GN=SYT1 PE=1 SV=1
10	AFDB:O08625	0.322	0.294	9.688E-34	523	0.278	0.252	O08625.pdb.gz	SYT10_RAT Synaptotagmin-10 OS=Rattus norvegicus OX=10116 GN=Syt10 PE=2 SV=2
11	PDB:3pfqA	0.251	0.229	6.052E-10	523	0.076	0.069	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:5iz5B	0.176	0.114	1.984E-8	746	0.091	0.058	5iz5B.pdb.gz
13	PDB:6kxkD	0.149	0.129	3.414E-7	553	0.082	0.071	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
14	PDB:5ixcA	0.183	0.129	8.505E-7	684	0.084	0.058	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5iz5A	0.171	0.108	1.181E-5	757	0.084	0.053	5iz5A.pdb.gz
16	PDB:5izrC	0.175	0.128	2.504E-5	659	0.080	0.058	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:5a50A	0.164	0.455	5.912E-5	165	0.051	0.145	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:5a52A	0.161	0.474	1.396E-4	154	0.042	0.130	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:1cjyA	0.170	0.130	1.926E-4	633	0.044	0.033	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
20	PDB:3nsjA	0.161	0.144	3.477E-4	530	0.038	0.034	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q920M7	0.0	938	470	0.951	0.960	SYT17_MOUSE Synaptotagmin-17 OS=Mus musculus OX=10090 GN=Syt17 PE=1 SV=1
2	Q9BSW7	0.0	980	474	1.000	1.000	SYT17_HUMAN Synaptotagmin-17 OS=Homo sapiens OX=9606 GN=SYT17 PE=1 SV=1
3	P21521	2.89e-67	225	474	0.264	0.264	SY65_DROME Synaptotagmin 1 OS=Drosophila melanogaster OX=7227 GN=Syt1 PE=1 SV=3
4	O43581	1.16e-65	218	403	0.262	0.308	SYT7_HUMAN Synaptotagmin-7 OS=Homo sapiens OX=9606 GN=SYT7 PE=1 SV=3
5	P41823	3.26e-65	218	428	0.276	0.306	SY65_APLCA Synaptotagmin-1 OS=Aplysia californica OX=6500 GN=SYT1 PE=1 SV=2
6	P46097	9.42e-65	217	422	0.247	0.277	SYT2_MOUSE Synaptotagmin-2 OS=Mus musculus OX=10090 GN=Syt2 PE=1 SV=1
7	P29101	1.21e-64	216	422	0.247	0.277	SYT2_RAT Synaptotagmin-2 OS=Rattus norvegicus OX=10116 GN=Syt2 PE=1 SV=1
8	Q8N9I0	2.12e-64	216	419	0.247	0.279	SYT2_HUMAN Synaptotagmin-2 OS=Homo sapiens OX=9606 GN=SYT2 PE=1 SV=2
9	P46096	9.30e-64	214	421	0.247	0.278	SYT1_MOUSE Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 PE=1 SV=1
10	P21707	1.14e-63	214	421	0.247	0.278	SYT1_RAT Synaptotagmin-1 OS=Rattus norvegicus OX=10116 GN=Syt1 PE=1 SV=3
11	P21579	1.46e-63	213	422	0.247	0.277	SYT1_HUMAN Synaptotagmin-1 OS=Homo sapiens OX=9606 GN=SYT1 PE=1 SV=1
12	P48018	1.76e-63	213	422	0.247	0.277	SYT1_BOVIN Synaptotagmin-1 OS=Bos taurus OX=9913 GN=SYT1 PE=1 SV=1
13	A0A075F932	1.91e-62	211	421	0.243	0.273	SYT1_ANSCY Synaptotagmin-1 OS=Anser cygnoides OX=8845 GN=SYT1 PE=2 SV=1
14	Q62747	9.24e-62	208	403	0.264	0.310	SYT7_RAT Synaptotagmin-7 OS=Rattus norvegicus OX=10116 GN=Syt7 PE=1 SV=1
15	D4P8S0	1.09e-61	210	488	0.234	0.227	D4P8S0_DANRE Synaptotagmin VIIb OS=Danio rerio OX=7955 GN=syt7 PE=2 SV=1
16	Q9R0N7	2.92e-61	207	403	0.255	0.300	SYT7_MOUSE Synaptotagmin-7 OS=Mus musculus OX=10090 GN=Syt7 PE=1 SV=1
17	Q59DP7	5.30e-61	202	283	0.232	0.389	Q59DP7_DROME Synaptotagmin 7, isoform F OS=Drosophila melanogaster OX=7227 GN=Syt7 PE=4 SV=1
18	P47861	1.26e-60	205	386	0.245	0.301	SYT5_RAT Synaptotagmin-5 OS=Rattus norvegicus OX=10116 GN=Syt5 PE=1 SV=1
19	Q9V4C4	7.53e-60	204	416	0.255	0.291	Q9V4C4_DROME Synaptotagmin 7, isoform A OS=Drosophila melanogaster OX=7227 GN=Syt7 PE=1 SV=4
20	P34693	3.76e-59	202	441	0.249	0.268	SYT1_CAEEL Synaptotagmin-1 OS=Caenorhabditis elegans OX=6239 GN=snt-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	2.6e-38	141.8	C2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347538

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324205	0.843	Charged multivesicular body protein 4a
2	9606.ENSP00000254976	0.702	Synaptosomal-associated protein 25
3	9606.ENSP00000351520	0.679	Ectonucleoside triphosphate diphosphohydrolase 4
4	9606.ENSP00000367756	0.672	Protein unc-13 homolog B
5	9606.ENSP00000314214	0.667	Vesicle-associated membrane protein 2
6	9606.ENSP00000351614	0.648	Synapsin-3
7	9606.ENSP00000356505	0.643	Neutrophil cytosol factor 2
8	9606.ENSP00000480050	0.641	Synapsin-2
9	9606.ENSP00000249647	0.624	Synaptosomal-associated protein 23
10	9606.ENSP00000289473	0.607	Neutrophil cytosol factor 1
11	9606.ENSP00000222812	0.602	Syntaxin-1A
12	9606.ENSP00000392105	0.598	Innate immunity activator protein
13	9606.ENSP00000272371	0.582	Otoferlin
14	9606.ENSP00000379602	0.577	Vesicle-associated membrane protein 1
15	9606.ENSP00000295987	0.573	Synapsin-1
16	9606.ENSP00000381436	0.570	Transcription cofactor vestigial-like protein 3
17	9606.ENSP00000324302	0.558	Syntaxin-binding protein 6
18	9606.ENSP00000305613	0.542	Complexin-1
19	9606.ENSP00000354960	0.542	Procollagen galactosyltransferase 2
20	9606.ENSP00000317714	0.540	Syntaxin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.952	cellular process
GO:0048518	0.862	positive regulation of biological process
GO:0048522	0.829	positive regulation of cellular process
GO:0051128	0.801	regulation of cellular component organization
GO:1903859	0.700	regulation of dendrite extension
GO:0045927	0.489	positive regulation of growth
GO:0030307	0.417	positive regulation of cell growth
GO:0048639	0.415	positive regulation of developmental growth
GO:0071840	0.402	cellular component organization or biogenesis
GO:0016043	0.373	cellular component organization
GO:0006810	0.366	transport
GO:0050896	0.363	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0016020	0.968	membrane
GO:0031982	0.933	vesicle
GO:0005794	0.919	Golgi apparatus
GO:0071944	0.912	cell periphery
GO:0031410	0.883	cytoplasmic vesicle
GO:0005886	0.873	plasma membrane
GO:0031984	0.657	organelle subcompartment
GO:0098791	0.445	Golgi apparatus subcompartment
GO:0005802	0.377	trans-Golgi network

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]