StarFunc result for job id Q9BSY9

User Input

>input (194 residues)
MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNA
SELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILC
GKEIPRWINRLAYFSSCIPFLQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVA
STAAGSRPGRHTKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BSY9	1.000	1.000	5.436E-38	194	1.000	1.000	Q9BSY9.pdb.gz	DESI2_HUMAN Deubiquitinase DESI2 OS=Homo sapiens OX=9606 GN=DESI2 PE=1 SV=1
2	AFDB:Q6DC39	0.774	0.766	1.336E-31	196	0.830	0.821	Q6DC39.pdb.gz	DESI2_DANRE Deubiquitinase DESI2 OS=Danio rerio OX=7955 GN=desi2 PE=2 SV=1
3	AFDB:Q385N7	0.643	0.200	2.517E-12	656	0.242	0.072	Q385N7.pdb.gz	Q385N7_TRYB2 PPPDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2980 PE=3 SV=1
4	AFDB:Q8X1T0	0.628	0.607	8.837E-12	201	0.211	0.204	Q8X1T0.pdb.gz	SDU1_SCHPO DeSI-like protein sdu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sdu1 PE=1 SV=1
5	AFDB:Q382J5	0.599	0.363	1.706E-11	334	0.278	0.162	Q382J5.pdb.gz	Q382J5_TRYB2 PPPDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5020 PE=3 SV=1
6	AFDB:Q9SFT9	0.581	0.435	1.560E-10	265	0.247	0.181	Q9SFT9.pdb.gz	Q9SFT9_ARATH PPPDE putative thiol peptidase family protein OS=Arabidopsis thaliana OX=3702 GN=T1B9.26 PE=1 SV=1
7	AFDB:Q382J0	0.608	0.505	3.605E-10	236	0.263	0.216	Q382J0.pdb.gz	Q382J0_TRYB2 PPPDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5070 PE=3 SV=1
8	AFDB:Q6ICB0	0.621	0.709	3.945E-9	168	0.227	0.262	Q6ICB0.pdb.gz	DESI1_HUMAN Desumoylating isopeptidase 1 OS=Homo sapiens OX=9606 GN=DESI1 PE=1 SV=1
9	PDB:2wp7A	0.608	0.734	1.298E-8	158	0.227	0.278	2wp7A.pdb.gz
10	AFDB:Q381Y2	0.560	0.214	6.965E-8	596	0.206	0.067	Q381Y2.pdb.gz	Q381Y2_TRYB2 PPPDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6150 PE=3 SV=1
11	PDB:6lpfB	0.140	0.037	3.490E-1	1006	0.046	0.009	6lpfB.pdb.gz	Molecular basis of the multifaceted functions of human leucyl-tRNA synthetase in protein synthesis and beyond.
12	AFDB:Q708S3	0.182	0.070	4.731E-1	558	0.088	0.030	Q708S3.pdb.gz	ASI4B_DANRE Acid-sensing ion channel 4-B OS=Danio rerio OX=7955 GN=asic4b PE=2 SV=1
13	PDB:5a60A	0.131	0.068	8.063E-1	429	0.057	0.026	5a60A.pdb.gz	Structural Determinants for Substrate Binding and Catalysis in Triphosphate Tunnel Metalloenzymes.
14	PDB:3lwbA	0.113	0.084	1.863	323	0.057	0.034	3lwbA.pdb.gz
15	PDB:7enar	0.193	0.184	1.863	206	0.052	0.049	7enar.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
16	PDB:6jzcB	0.184	0.154	1.978	253	0.082	0.063	6jzcB.pdb.gz
17	PDB:7lt3F	0.170	0.156	2.229	213	0.108	0.099	7lt3F.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
18	PDB:6r99A	0.202	0.154	2.512	285	0.067	0.046	6r99A.pdb.gz
19	PDB:7pdzE	0.119	0.090	2.512	272	0.088	0.062	7pdzE.pdb.gz	A barbed end interference mechanism reveals how capping protein promotes nucleation in branched actin networks.
20	PDB:6xlbC1	0.084	0.061	2.667	284	0.062	0.042	6xlbC1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BSY9	2.90e-145	403	194	1.000	1.000	DESI2_HUMAN Deubiquitinase DESI2 OS=Homo sapiens OX=9606 GN=DESI2 PE=1 SV=1
2	Q9D291	1.22e-141	394	194	0.969	0.969	DESI2_MOUSE Deubiquitinase DESI2 OS=Mus musculus OX=10090 GN=Desi2 PE=1 SV=1
3	Q6DC39	1.65e-113	323	196	0.789	0.781	DESI2_DANRE Deubiquitinase DESI2 OS=Danio rerio OX=7955 GN=desi2 PE=2 SV=1
4	Q8X1T0	9.51e-21	87.4	201	0.222	0.214	SDU1_SCHPO DeSI-like protein sdu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sdu1 PE=1 SV=1
5	Q382J5	3.40e-18	82.8	334	0.284	0.165	Q382J5_TRYB2 PPPDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5020 PE=3 SV=1
6	Q382J0	8.32e-17	77.4	236	0.211	0.174	Q382J0_TRYB2 PPPDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5070 PE=3 SV=1
7	Q385N7	1.28e-16	79.3	656	0.237	0.070	Q385N7_TRYB2 PPPDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2980 PE=3 SV=1
8	Q9SFT9	6.20e-12	64.7	265	0.222	0.162	Q9SFT9_ARATH PPPDE putative thiol peptidase family protein OS=Arabidopsis thaliana OX=3702 GN=T1B9.26 PE=1 SV=1
9	Q9CQT7	2.34e-10	58.9	168	0.201	0.232	DESI1_MOUSE Desumoylating isopeptidase 1 OS=Mus musculus OX=10090 GN=Desi1 PE=1 SV=1
10	Q6ICB0	5.80e-10	57.8	168	0.201	0.232	DESI1_HUMAN Desumoylating isopeptidase 1 OS=Homo sapiens OX=9606 GN=DESI1 PE=1 SV=1
11	Q38FI8	1.00e-08	56.2	1051	0.299	0.055	Q38FI8_TRYB2 mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2050 PE=3 SV=1
12	Q381Y2	0.47	33.5	596	0.144	0.047	Q381Y2_TRYB2 PPPDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6150 PE=3 SV=1
13	O35095	1.9	31.6	729	0.077	0.021	NCDN_RAT Neurochondrin OS=Rattus norvegicus OX=10116 GN=Ncdn PE=1 SV=2
14	Q382X6	1.9	31.6	621	0.108	0.034	Q382X6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3870 PE=4 SV=1
15	Q9Z0E0	1.9	31.6	729	0.077	0.021	NCDN_MOUSE Neurochondrin OS=Mus musculus OX=10090 GN=Ncdn PE=1 SV=1
16	Q9UBB6	2.1	31.6	729	0.077	0.021	NCDN_HUMAN Neurochondrin OS=Homo sapiens OX=9606 GN=NCDN PE=1 SV=1
17	Q03149	4.1	30.8	2157	0.093	0.008	WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=wA PE=1 SV=2
18	Q494V2	4.4	30.4	611	0.103	0.033	CP100_HUMAN Cilia- and flagella-associated protein 100 OS=Homo sapiens OX=9606 GN=CFAP100 PE=1 SV=1
19	A0A0A0MTR2	5.0	30.0	499	0.082	0.032	A0A0A0MTR2_HUMAN 2-oxoglutarate and iron dependent oxygenase domain containing 1 OS=Homo sapiens OX=9606 GN=OGFOD1 PE=1 SV=1
20	C6KTF7	5.9	30.0	3954	0.098	0.005	C6KTF7_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0632500 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04970 LRAT	4.6e+02	12.5	Lecithin retinol acyltransferase
2	PF05903 Peptidase_C97	2e-39	146.3	PPPDE putative peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004860

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004850	0.689	Catsper channel auxiliary subunit epsilon
2	61853.ENSNLEP00000000909	0.586	Ubiquitin specific peptidase like 1
3	61853.ENSNLEP00000004966	0.566	EF-hand calcium binding domain 2
4	61853.ENSNLEP00000015311	0.524	Cytoplasmic polyadenylation element binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990380	1.000	K48-linked deubiquitinase activity
GO:0061578	1.000	K63-linked deubiquitinase activity
GO:0004843	1.000	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0002009	0.995	morphogenesis of an epithelium
GO:0060026	0.992	convergent extension
GO:0007369	0.984	gastrulation
GO:0060027	0.970	convergent extension involved in gastrulation
GO:0071704	0.761	organic substance metabolic process
GO:0044238	0.730	primary metabolic process
GO:0006807	0.720	nitrogen compound metabolic process
GO:1901564	0.686	organonitrogen compound metabolic process
GO:0043170	0.674	macromolecule metabolic process
GO:0070647	0.617	protein modification by small protein conjugation or removal
GO:0050789	0.387	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.837	intracellular membrane-bounded organelle
GO:0005829	0.562	cytosol
GO:0070013	0.478	intracellular organelle lumen
GO:0031981	0.458	nuclear lumen
GO:0005654	0.431	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]