StarFunc result for job id Q9BT04

User Input

>input (418 residues)
MGEEGTGGTVHLLCLAASSGVPLFCRSSRGGAPARQQLPFSVIGSLNGVHMFGQNLEVQL
SSARTENTTVVWKSFHDSITLIVLSSEVGISELRLERLLQMVFGAMVLLVGLEELTNIRN
VERLKKDLRASYCLIDSFLGDSELIGDLTQCVDCVIPPEGSLLQEALSGFAEAAGTTFVS
LVVSGRVVAATEGWWRLGTPEAVLLPWLVGSLPPQTARDYPVYLPHGSPTVPHRLLTLTL
LPSLELCLLCGPSPPLSQLYPQLLERWWQPLLDPLRACLPLGPRALPSGFPLHTDILGLL
LLHLELKRCLFTVEPLGDKEPSPEQRRRLLRNFYTLVTSTHFPPEPGPPEKTEDEVYQAQ
LPRACYLVLGTEEPGTGVRLVALQLGLRRLLLLLSPQSPTHGLRSLATHTLHALTPLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BT04	1.000	1.000	1.217E-83	418	1.000	1.000	Q9BT04.pdb.gz	FUZZY_HUMAN Protein fuzzy homolog OS=Homo sapiens OX=9606 GN=FUZ PE=1 SV=1
2	AFDB:Q3UYI6	0.963	0.970	5.296E-73	415	0.864	0.870	Q3UYI6.pdb.gz	FUZZY_MOUSE Protein fuzzy homolog OS=Mus musculus OX=10090 GN=Fuz PE=1 SV=2
3	PDB:7q3dC	0.905	0.961	1.499E-66	393	0.938	0.997	7q3dC.pdb.gz
4	PDB:7q3eC	0.908	0.967	2.540E-60	392	0.825	0.880	7q3eC.pdb.gz	Structure of the ciliogenesis-associated CPLANE complex.
5	AFDB:A0A1L8FNF3	0.899	0.899	1.810E-51	418	0.512	0.512	A0A1L8FNF3.pdb.gz	A0A1L8FNF3_XENLA Protein fuzzy homolog isoform X1 OS=Xenopus laevis OX=8355 GN=fuz.L PE=3 SV=1
6	AFDB:O16868	0.815	0.819	8.031E-31	416	0.270	0.272	O16868.pdb.gz	FUZZY_DROME Protein fuzzy OS=Drosophila melanogaster OX=7227 GN=fuz PE=1 SV=1
7	AFDB:Q9SKN1	0.751	0.532	4.858E-19	607	0.134	0.092	Q9SKN1.pdb.gz	MON1_ARATH Vacuolar fusion protein MON1 homolog OS=Arabidopsis thaliana OX=3702 GN=MON1 PE=1 SV=2
8	AFDB:Q10150	0.746	0.621	6.705E-19	513	0.151	0.123	Q10150.pdb.gz	MON1_SCHPO Vacuolar fusion protein mon1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mon1 PE=3 SV=1
9	AFDB:Q7L1V2	0.749	0.584	7.878E-19	547	0.218	0.166	Q7L1V2.pdb.gz	MON1B_HUMAN Vacuolar fusion protein MON1 homolog B OS=Homo sapiens OX=9606 GN=MON1B PE=1 SV=1
10	AFDB:Q8MRZ0	0.713	0.577	4.428E-17	528	0.151	0.119	Q8MRZ0.pdb.gz	Q8MRZ0_DROME Vacuolar fusion protein MON1 homolog OS=Drosophila melanogaster OX=7227 GN=Mon1 PE=2 SV=1
11	AFDB:Q86VX9	0.746	0.494	4.930E-17	652	0.170	0.109	Q86VX9.pdb.gz	MON1A_HUMAN Vacuolar fusion protein MON1 homolog A OS=Homo sapiens OX=9606 GN=MON1A PE=1 SV=3
12	AFDB:Q9BI89	0.738	0.677	1.993E-16	459	0.141	0.129	Q9BI89.pdb.gz	Q9BI89_CAEEL Vacuolar fusion protein MON1 homolog OS=Caenorhabditis elegans OX=6239 GN=sand-1 PE=1 SV=2
13	PDB:7q3dB	0.585	0.548	6.888E-12	453	0.146	0.135	7q3dB.pdb.gz
14	PDB:7q3eB	0.585	0.501	2.017E-11	503	0.146	0.121	7q3eB.pdb.gz	Structure of the ciliogenesis-associated CPLANE complex.
15	PDB:2jkrS	0.216	0.552	4.789E-3	142	0.031	0.092	2jkrS.pdb.gz	A Structural Explanation for the Binding of Endocytic Dileucine Motifs by the Ap2 Complex.
16	PDB:2j3tC	0.208	0.495	5.626E-3	141	0.053	0.156	2j3tC.pdb.gz
17	PDB:7rwaM	0.248	0.270	6.610E-3	379	0.100	0.111	7rwaM.pdb.gz	Structural basis of an endocytic checkpoint that primes the AP2 clathrin adaptor for cargo internalization.
18	PDB:4hmyS	0.204	0.490	8.647E-3	145	0.036	0.103	4hmyS.pdb.gz	Structural Basis for Recruitment and Activation of the AP-1 Clathrin Adaptor Complex by Arf1.
19	PDB:5a1uF	0.206	0.518	1.194E-2	139	0.062	0.187	5a1uF.pdb.gz
20	PDB:6b9xB	0.176	0.465	1.194E-2	126	0.041	0.135	6b9xB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UYI6	0.0	642	415	0.864	0.870	FUZZY_MOUSE Protein fuzzy homolog OS=Mus musculus OX=10090 GN=Fuz PE=1 SV=2
2	Q9BT04	0.0	822	418	1.000	1.000	FUZZY_HUMAN Protein fuzzy homolog OS=Homo sapiens OX=9606 GN=FUZ PE=1 SV=1
3	A0A1L8FNF3	6.55e-138	402	418	0.517	0.517	A0A1L8FNF3_XENLA Protein fuzzy homolog isoform X1 OS=Xenopus laevis OX=8355 GN=fuz.L PE=3 SV=1
4	O16868	1.62e-40	150	416	0.294	0.296	FUZZY_DROME Protein fuzzy OS=Drosophila melanogaster OX=7227 GN=fuz PE=1 SV=1
5	Q387Q0	0.19	36.6	577	0.103	0.075	Q387Q0_TRYB2 ATP-dependent zinc metallopeptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0110 PE=3 SV=1
6	A0A0G2K3L9	3.8	32.3	1142	0.048	0.018	A0A0G2K3L9_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2
7	D3ZZ81	4.4	32.3	1190	0.048	0.017	D3ZZ81_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=1
8	S4R1D4	5.6	31.6	562	0.048	0.036	S4R1D4_MOUSE Protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF),-interacting protein (liprin), alpha 1 (Fragment) OS=Mus musculus OX=10090 GN=Ppfia1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19036 Fuz_longin_1	2.5e-29	113.4	First Longin domain of FUZ, MON1 and HPS1
2	PF19037 Fuz_longin_2	7e-10	50.2	Second Longin domain of FUZ, MON1 and HPS1
3	PF19038 Fuz_longin_3	1.2e-08	46.9	Third Longin domain of FUZ, MON1 and HPS1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313309

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334003	0.994	Protein inturned
2	9606.ENSP00000364749	0.988	REM2- and Rab-like small GTPase 1
3	9606.ENSP00000379258	0.946	Transcriptional activator GLI3
4	9606.ENSP00000228682	0.930	Zinc finger protein GLI1
5	9606.ENSP00000358918	0.923	Suppressor of fused homolog
6	9606.ENSP00000390436	0.922	Zinc finger protein GLI2
7	9606.ENSP00000272321	0.868	WD repeat-containing and planar cell polarity effector protein fritz homolog
8	9606.ENSP00000238628	0.744	Intraflagellar transport proteins
9	9606.ENSP00000005340	0.670	Segment polarity protein dishevelled homolog DVL-2
10	9606.ENSP00000357040	0.632	Vang-like protein 2
11	9606.ENSP00000368169	0.618	Segment polarity protein dishevelled homolog DVL-1
12	9606.ENSP00000347672	0.600	VANGL planar cell polarity protein 1
13	9606.ENSP00000345064	0.589	Prickle-like protein 1
14	9606.ENSP00000323580	0.576	Intraflagellar transport protein 88 homolog
15	9606.ENSP00000312778	0.566	Intraflagellar transport protein 80 homolog
16	9606.ENSP00000349486	0.537	Protein scribble homolog
17	9606.ENSP00000316054	0.512	Segment polarity protein dishevelled homolog DVL-3
18	9606.ENSP00000369080	0.509	Sperm flagellar protein 1
19	9606.ENSP00000300935	0.507	Ras-related protein Rab-8A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0044087	0.986	regulation of cellular component biogenesis
GO:0021915	0.986	neural tube development
GO:0048598	0.985	embryonic morphogenesis
GO:0002009	0.985	morphogenesis of an epithelium
GO:0070925	0.984	organelle assembly
GO:0060606	0.978	tube closure
GO:0014020	0.978	primary neural tube formation
GO:0048522	0.977	positive regulation of cellular process
GO:0044782	0.974	cilium organization
GO:0030031	0.967	cell projection assembly
GO:0060271	0.961	cilium assembly
GO:1902017	0.957	regulation of cilium assembly
GO:0051130	0.953	positive regulation of cellular component organization
GO:0048523	0.945	negative regulation of cellular process
GO:0001843	0.938	neural tube closure
GO:0044089	0.908	positive regulation of cellular component biogenesis
GO:1905515	0.884	non-motile cilium assembly
GO:0010638	0.806	positive regulation of organelle organization
GO:0031346	0.749	positive regulation of cell projection organization
GO:0120034	0.710	positive regulation of plasma membrane bounded cell projection assembly
GO:1902117	0.693	positive regulation of organelle assembly
GO:0019222	0.500	regulation of metabolic process
GO:0060255	0.482	regulation of macromolecule metabolic process
GO:0080090	0.448	regulation of primary metabolic process
GO:0051171	0.448	regulation of nitrogen compound metabolic process
GO:0010468	0.443	regulation of gene expression
GO:0010604	0.437	positive regulation of macromolecule metabolic process
GO:0051179	0.377	localization
GO:0051173	0.319	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031982	0.997	vesicle
GO:0043231	0.958	intracellular membrane-bounded organelle
GO:0005829	0.948	cytosol
GO:0005576	0.893	extracellular region
GO:0005615	0.872	extracellular space
GO:0043230	0.848	extracellular organelle
GO:0070062	0.842	extracellular exosome
GO:0032991	0.835	protein-containing complex
GO:0070013	0.424	intracellular organelle lumen
GO:0012505	0.415	endomembrane system
GO:0031410	0.345	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]