StarFunc result for job id Q9BT17

User Input

>input (334 residues)
MRLTPRALCSAAQAAWRENFPLCGRDVARWFPGHMAKGLKKMQSSLKLVDCIIEVHDARI
PLSGRNPLFQETLGLKPHLLVLNKMDLADLTEQQKIMQHLEGEGLKNVIFTNCVKDENVK
QIIPMVTELIGRSHRYHRKENLEYCIMVIGVPNVGKSSLINSLRRQHLRKGKATRVGGEP
GITRAVMSKIQVSERPLMFLLDTPGVLAPRIESVETGLKLALCGTVLDHLVGEETMADYL
LYTLNKHQRFGYVQHYGLGSACDNVERVLKSVAVKLGKTQKVKVLTGTGNVNIIQPNYPA
AARDFLQTFRRGLLGSVMLDLDVLRGHPPAETLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BT17	1.000	1.000	1.877E-66	334	1.000	1.000	Q9BT17.pdb.gz	MTG1_HUMAN Mitochondrial ribosome-associated GTPase 1 OS=Homo sapiens OX=9606 GN=MTG1 PE=1 SV=2
2	AFDB:Q8R2R6	0.943	0.966	2.574E-51	326	0.790	0.810	Q8R2R6.pdb.gz	MTG1_MOUSE Mitochondrial ribosome-associated GTPase 1 OS=Mus musculus OX=10090 GN=Mtg1 PE=1 SV=2
3	PDB:7pd3z	0.882	0.945	4.122E-45	311	0.931	1.000	7pd3z.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
4	PDB:7o9kC	0.665	0.851	3.187E-34	255	0.763	1.000	7o9kC.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
5	AFDB:O31743	0.724	0.851	4.334E-21	282	0.269	0.319	O31743.pdb.gz	RBGA_BACSU Ribosome biogenesis GTPase A OS=Bacillus subtilis (strain 168) OX=224308 GN=rbgA PE=1 SV=1
6	AFDB:Q8L607	0.707	0.616	1.179E-20	386	0.299	0.259	Q8L607.pdb.gz	SIN2_ARATH Short integuments 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SIN2 PE=1 SV=1
7	AFDB:Q8H1F6	0.699	0.631	9.006E-19	372	0.266	0.239	Q8H1F6.pdb.gz	DGP3_ARATH DAR GTPase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DGP3 PE=2 SV=1
8	PDB:1pujA	0.688	0.868	1.961E-18	261	0.249	0.318	1pujA.pdb.gz	Structure of the YlqF GTPase from B. subtilis
9	AFDB:O74776	0.710	0.722	1.099E-17	328	0.284	0.290	O74776.pdb.gz	MTG1_SCHPO Mitochondrial GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mtg1 PE=3 SV=1
10	AFDB:Q03151	0.731	0.668	9.383E-16	367	0.275	0.251	Q03151.pdb.gz	MTG1_YEAST Mitochondrial GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTG1 PE=1 SV=1
11	AFDB:Q57TY2	0.671	0.389	2.636E-14	601	0.222	0.123	Q57TY2.pdb.gz	Q57TY2_TRYB2 Nucleolar GTP-binding protein 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.30D13.330 PE=3 SV=1
12	AFDB:Q38E75	0.627	0.480	5.429E-14	451	0.254	0.188	Q38E75.pdb.gz	Q38E75_TRYB2 GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0810 PE=1 SV=1
13	AFDB:Q13823	0.664	0.319	1.058E-13	731	0.201	0.092	Q13823.pdb.gz	NOG2_HUMAN Nucleolar GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=GNL2 PE=1 SV=1
14	PDB:6yxyEM	0.580	0.586	2.514E-12	330	0.249	0.252	6yxyEM.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
15	PDB:6yxxEM	0.570	0.610	6.320E-11	308	0.210	0.227	6yxxEM.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
16	PDB:5t62W	0.619	0.671	5.524E-10	306	0.201	0.219	5t62W.pdb.gz	Nmd3 is a structural mimic of eIF5A, and activates the cpGTPase Lsg1 during 60S ribosome biogenesis.
17	PDB:7btbm	0.650	0.478	2.217E-9	469	0.216	0.154	7btbm.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
18	PDB:6n8jm	0.599	0.536	5.104E-9	378	0.216	0.190	6n8jm.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
19	PDB:6n8nW	0.612	0.548	7.779E-8	377	0.189	0.167	6n8nW.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
20	PDB:7of1m	0.433	0.609	1.003E-6	229	0.168	0.245	7of1m.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K900	0.0	611	300	0.895	0.997	A8K900_HUMAN Mitochondrial GTPase 1 OS=Homo sapiens OX=9606 PE=1 SV=1
2	Q8R2R6	0.0	540	326	0.790	0.810	MTG1_MOUSE Mitochondrial ribosome-associated GTPase 1 OS=Mus musculus OX=10090 GN=Mtg1 PE=1 SV=2
3	Q9BT17	0.0	689	334	1.000	1.000	MTG1_HUMAN Mitochondrial ribosome-associated GTPase 1 OS=Homo sapiens OX=9606 GN=MTG1 PE=1 SV=2
4	O31743	1.56e-44	155	282	0.257	0.305	RBGA_BACSU Ribosome biogenesis GTPase A OS=Bacillus subtilis (strain 168) OX=224308 GN=rbgA PE=1 SV=1
5	Q8L607	4.31e-42	152	386	0.272	0.236	SIN2_ARATH Short integuments 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SIN2 PE=1 SV=1
6	O74776	6.10e-38	139	328	0.302	0.308	MTG1_SCHPO Mitochondrial GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mtg1 PE=3 SV=1
7	Q8H1F6	6.65e-27	110	372	0.275	0.247	DGP3_ARATH DAR GTPase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DGP3 PE=2 SV=1
8	Q38E75	4.23e-25	107	451	0.281	0.208	Q38E75_TRYB2 GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0810 PE=1 SV=1
9	Q03151	2.18e-24	103	367	0.281	0.256	MTG1_YEAST Mitochondrial GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTG1 PE=1 SV=1
10	Q9NVN8	1.08e-14	77.0	582	0.254	0.146	GNL3L_HUMAN Guanine nucleotide-binding protein-like 3-like protein OS=Homo sapiens OX=9606 GN=GNL3L PE=1 SV=1
11	Q21086	1.38e-14	76.6	556	0.266	0.160	GNL3_CAEEL Guanine nucleotide-binding protein-like 3 homolog OS=Caenorhabditis elegans OX=6239 GN=nst-1 PE=3 SV=1
12	Q7SZX9	3.82e-13	72.4	565	0.213	0.126	Q7SZX9_DANRE Guanine nucleotide-binding protein-like 3 OS=Danio rerio OX=7955 GN=SI:zK13A21.8 PE=1 SV=1
13	Q57TY2	3.49e-12	69.3	601	0.228	0.126	Q57TY2_TRYB2 Nucleolar GTP-binding protein 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.30D13.330 PE=3 SV=1
14	Q9M8Z5	8.24e-11	65.1	582	0.201	0.115	NSN1_ARATH Guanine nucleotide-binding protein-like NSN1 OS=Arabidopsis thaliana OX=3702 GN=NSN1 PE=1 SV=1
15	Q7JXU4	2.45e-10	63.9	674	0.237	0.117	Q7JXU4_DROME Nucleolar GTP-binding protein 2 OS=Drosophila melanogaster OX=7227 GN=Ns2 PE=1 SV=1
16	Q386P6	3.12e-10	63.2	486	0.165	0.113	Q386P6_TRYB2 GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0240 PE=4 SV=1
17	Q6DRP2	5.71e-09	59.7	561	0.171	0.102	GNL3_DANRE Guanine nucleotide-binding protein-like 3 OS=Danio rerio OX=7955 GN=gnl3 PE=2 SV=1
18	Q9BVP2	7.59e-09	59.3	549	0.159	0.097	GNL3_HUMAN Guanine nucleotide-binding protein-like 3 OS=Homo sapiens OX=9606 GN=GNL3 PE=1 SV=2
19	Q8MT06	9.61e-09	58.9	581	0.243	0.139	GNL3_DROME Guanine nucleotide-binding protein-like 3 homolog OS=Drosophila melanogaster OX=7227 GN=Ns1 PE=1 SV=2
20	Q8CI11	1.87e-08	57.8	538	0.210	0.130	GNL3_MOUSE Guanine nucleotide-binding protein-like 3 OS=Mus musculus OX=10090 GN=Gnl3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	29	16.5	AAA ATPase domain
2	PF13238 AAA_18	2.3e+02	13.7	AAA domain
3	PF13401 AAA_22	4	19.1	AAA domain
4	PF13479 AAA_24	4.4e+02	12.0	AAA domain
5	PF04548 AIG1	3e+02	12.1	AIG1 family
6	PF00025 Arf	34	15.3	ADP-ribosylation factor family
7	PF17805 AsnC_trans_reg2	2.7e+02	13.1	AsnC-like ligand binding domain
8	PF03029 ATP_bind_1	5.2e+02	11.8	Conserved hypothetical ATP binding protein
9	PF00350 Dynamin_N	24	16.4	Dynamin family
10	PF02421 FeoB_N	0.0024	28.9	Ferrous iron transport protein B
11	PF00009 GTP_EFTU	0.63	21.1	Elongation factor Tu GTP binding domain
12	PF05049 IIGP	69	14.0	Interferon-inducible GTPase (IIGP)
13	PF01926 MMR_HSR1	2.2e-09	48.8	50S ribosome-binding GTPase
14	PF16897 MMR_HSR1_Xtn	1.8e+02	13.5	C-terminal region of MMR_HSR1 domain
15	PF10662 PduV-EutP	1.5	20.0	Ethanolamine utilisation - propanediol utilisation
16	PF00519 PPV_E1_C	6e+02	10.9	Papillomavirus helicase
17	PF00071 Ras	89	14.1	Ras family
18	PF08477 Roc	1e+02	14.5	Ras of Complex, Roc, domain of DAPkinase
19	PF03193 RsgA_GTPase	0.0012	30.3	RsgA GTPase
20	PF00735 Septin	2.5e+02	12.4	Septin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323047

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433712	0.934	Shadow of prion protein
2	9606.ENSP00000362014	0.902	Dynamin-1
3	9606.ENSP00000378974	0.901	Mitogen-activated protein kinase 8
4	9606.ENSP00000172229	0.900	Tumor necrosis factor receptor superfamily member 16
5	9606.ENSP00000256935	0.900	Dedicator of cytokinesis protein 2
6	9606.ENSP00000260402	0.900	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
7	9606.ENSP00000261890	0.900	Ras-related protein Rab-11A
8	9606.ENSP00000262958	0.900	Guanine nucleotide-binding protein subunit alpha-15
9	9606.ENSP00000265062	0.900	Ras-related protein Rab-7a
10	9606.ENSP00000273047	0.900	Ras-related protein Rab-5A
11	9606.ENSP00000295683	0.900	C-X-C chemokine receptor type 1
12	9606.ENSP00000306512	0.900	Interleukin-8
13	9606.ENSP00000312185	0.900	Engulfment and cell motility protein 1
14	9606.ENSP00000312999	0.900	Guanine nucleotide-binding protein G(i) subunit alpha-2
15	9606.ENSP00000319635	0.900	C-X-C chemokine receptor type 2
16	9606.ENSP00000334051	0.900	Guanine nucleotide-binding protein G(olf) subunit alpha
17	9606.ENSP00000334448	0.900	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
18	9606.ENSP00000338185	0.900	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
19	9606.ENSP00000348461	0.900	Ras-related C3 botulinum toxin substrate 1
20	9606.ENSP00000352157	0.900	Mitogen-activated protein kinase 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003924	1.000	GTPase activity
GO:0097159	0.593	organic cyclic compound binding
GO:1901363	0.591	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0080090	0.977	regulation of primary metabolic process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0031326	0.973	regulation of cellular biosynthetic process
GO:0010468	0.969	regulation of gene expression
GO:0010556	0.956	regulation of macromolecule biosynthetic process
GO:0051246	0.939	regulation of protein metabolic process
GO:0062125	0.934	regulation of mitochondrial gene expression
GO:0006417	0.906	regulation of translation
GO:0070129	0.876	regulation of mitochondrial translation
GO:0009987	0.779	cellular process
GO:0051239	0.680	regulation of multicellular organismal process
GO:0044057	0.648	regulation of system process
GO:0071704	0.585	organic substance metabolic process
GO:0006807	0.513	nitrogen compound metabolic process
GO:0044237	0.393	cellular metabolic process
GO:0044238	0.379	primary metabolic process
GO:0043170	0.310	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.999	membrane
GO:0070013	0.997	intracellular organelle lumen
GO:0043232	0.982	intracellular non-membrane-bounded organelle
GO:0031090	0.972	organelle membrane
GO:0031975	0.948	envelope
GO:0031967	0.803	organelle envelope
GO:0005840	0.797	ribosome
GO:0005759	0.773	mitochondrial matrix
GO:0005740	0.737	mitochondrial envelope
GO:0000313	0.729	organellar ribosome
GO:0031966	0.727	mitochondrial membrane
GO:0005761	0.711	mitochondrial ribosome
GO:0019866	0.668	organelle inner membrane
GO:0005743	0.655	mitochondrial inner membrane
GO:0032991	0.356	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	1.000	GTP + H2O = GDP + H(+) + phosphate

[back to server]