StarFunc result for job id Q9BT49

User Input

>input (309 residues)
MPRHCSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEY
IYFCSKHFEEDCFELVGISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPAEVSRL
RRCRKRCSEGRGPTTPFSPPPPADVTCFPVEEASAPATLPASPAGRLEPGLSSPFSDLLG
PLGAQADEAGCSAQPSPERQPSPLEPRPVSPSAYMLRLPPPAGAYIQNEHSYQVGSALLW
KRRAEAALDALDKAQRQLQACKRREQRLRLRLTKLQQERAREKRAQADARQTLKEHVQDF
AMQLSSSMA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BT49	1.000	1.000	2.120E-52	309	1.000	1.000	Q9BT49.pdb.gz	THAP7_HUMAN THAP domain-containing protein 7 OS=Homo sapiens OX=9606 GN=THAP7 PE=1 SV=2
2	AFDB:Q7Z6K1	0.342	0.285	2.065E-9	395	0.243	0.190	Q7Z6K1.pdb.gz	THAP5_HUMAN THAP domain-containing protein 5 OS=Homo sapiens OX=9606 GN=THAP5 PE=1 SV=2
3	AFDB:P21272	0.193	0.200	3.703E-1	297	0.197	0.205	P21272.pdb.gz	CEBPB_RAT CCAAT/enhancer-binding protein beta OS=Rattus norvegicus OX=10116 GN=Cebpb PE=1 SV=1
4	AFDB:Q7T2F8	0.221	0.075	9.480E-1	910	0.104	0.035	Q7T2F8.pdb.gz
5	AFDB:P97525	0.143	0.099	1.084	492	0.162	0.102	P97525.pdb.gz	TNR8_RAT Tumor necrosis factor receptor superfamily member 8 OS=Rattus norvegicus OX=10116 GN=Tnfrsf8 PE=2 SV=2
6	AFDB:F6PC33	0.229	0.062	1.160	1258	0.120	0.029	F6PC33.pdb.gz
7	AFDB:Q585Z5	0.197	0.220	1.517	274	0.097	0.109	Q585Z5.pdb.gz	Q585Z5_TRYB2 SH3 domain protein, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.370 PE=4 SV=1
8	AFDB:Q06547	0.181	0.144	1.622	395	0.136	0.106	Q06547.pdb.gz	GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens OX=9606 GN=GABPB1 PE=1 SV=2
9	AFDB:Q12495	0.181	0.104	1.622	606	0.126	0.064	Q12495.pdb.gz	RLF2_YEAST Chromatin assembly factor 1 subunit p90 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RLF2 PE=1 SV=1
10	AFDB:P81069	0.147	0.113	1.735	414	0.129	0.097	P81069.pdb.gz	GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus OX=10090 GN=Gabpb2 PE=1 SV=2
11	PDB:7w59R	0.155	0.171	2.156	280	0.065	0.071	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
12	PDB:7oa6B	0.058	0.098	2.820	152	0.042	0.086	7oa6B.pdb.gz	Phosphorylation activates the yeast small heat shock protein Hsp26 by weakening domain contacts in the oligomer ensemble.
13	PDB:7ajuCL	0.118	0.050	3.689	808	0.068	0.026	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:7ajtCL	0.140	0.063	5.520	781	0.074	0.029	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:5mpsK	0.089	0.127	6.752	187	0.052	0.086	5mpsK.pdb.gz	Structure of a spliceosome remodelled for exon ligation.
16	PDB:7d4iRJ	0.147	0.068	6.752	738	0.068	0.028	7d4iRJ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
17	PDB:7dvqR	0.169	0.211	7.723	241	0.068	0.087	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:7ung1	0.051	0.056	7.723	272	0.036	0.040	7ung1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
19	PDB:4v6wAV	0.089	0.254	8.833	82	0.032	0.122	4v6wAV.pdb.gz	Structures of the human and Drosophila 80S ribosome.
20	PDB:6hhqb	0.063	0.151	9.446	97	0.023	0.072	6hhqb.pdb.gz	Understanding the role of intermolecular interactions between lissoclimides and the eukaryotic ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BT49	0.0	628	309	1.000	1.000	THAP7_HUMAN THAP domain-containing protein 7 OS=Homo sapiens OX=9606 GN=THAP7 PE=1 SV=2
2	Q9H5L6	8.88e-17	83.2	903	0.152	0.052	THAP9_HUMAN DNA transposase THAP9 OS=Homo sapiens OX=9606 GN=THAP9 PE=1 SV=2
3	Q9H0W7	2.71e-11	64.3	228	0.142	0.193	THAP2_HUMAN THAP domain-containing protein 2 OS=Homo sapiens OX=9606 GN=THAP2 PE=1 SV=1
4	Q8TBB0	2.67e-10	61.6	222	0.104	0.144	THAP6_HUMAN THAP domain-containing protein 6 OS=Homo sapiens OX=9606 GN=THAP6 PE=1 SV=1
5	Q7Z6K1	2.98e-10	62.8	395	0.117	0.091	THAP5_HUMAN THAP domain-containing protein 5 OS=Homo sapiens OX=9606 GN=THAP5 PE=1 SV=2
6	Q8WY91	2.47e-09	60.5	577	0.113	0.061	THAP4_HUMAN Peroxynitrite isomerase THAP4 OS=Homo sapiens OX=9606 GN=THAP4 PE=1 SV=2
7	Q8NA92	1.17e-08	57.4	274	0.133	0.150	THAP8_HUMAN THAP domain-containing protein 8 OS=Homo sapiens OX=9606 GN=THAP8 PE=1 SV=1
8	Q8WTV1	6.09e-08	54.7	239	0.100	0.130	THAP3_HUMAN THAP domain-containing protein 3 OS=Homo sapiens OX=9606 GN=THAP3 PE=1 SV=1
9	Q9CUX1	3.53e-04	44.7	758	0.107	0.044	P52K_MOUSE 52 kDa repressor of the inhibitor of the protein kinase OS=Mus musculus OX=10090 GN=Thap12 PE=2 SV=2
10	O43422	4.18e-04	44.3	761	0.107	0.043	P52K_HUMAN 52 kDa repressor of the inhibitor of the protein kinase OS=Homo sapiens OX=9606 GN=THAP12 PE=1 SV=2
11	Q9NVV9	5.33e-04	42.7	213	0.104	0.150	THAP1_HUMAN THAP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THAP1 PE=1 SV=1
12	Q9P2Z0	0.014	38.9	257	0.104	0.125	THA10_HUMAN THAP domain-containing protein 10 OS=Homo sapiens OX=9606 GN=THAP10 PE=1 SV=1
13	A0A0A0MSU1	0.26	35.4	663	0.091	0.042	A0A0A0MSU1_HUMAN RUNX1 partner transcriptional co-repressor 1 OS=Homo sapiens OX=9606 GN=RUNX1T1 PE=1 SV=1
14	Q06455	0.27	35.4	604	0.091	0.046	MTG8_HUMAN Protein CBFA2T1 OS=Homo sapiens OX=9606 GN=RUNX1T1 PE=1 SV=2
15	W8FW32	0.28	35.4	567	0.091	0.049	W8FW32_HUMAN CBFA2T1 isoform r1t1-7d56 OS=Homo sapiens OX=9606 GN=RUNX1T1 PE=2 SV=1
16	A8DYP0	0.50	34.7	4218	0.074	0.005	OBSCN_DROME Obscurin OS=Drosophila melanogaster OX=7227 GN=Unc-89 PE=1 SV=1
17	Q15018	0.87	33.5	415	0.052	0.039	ABRX2_HUMAN BRISC complex subunit Abraxas 2 OS=Homo sapiens OX=9606 GN=ABRAXAS2 PE=1 SV=2
18	Q3TCJ1	0.98	33.5	415	0.052	0.039	ABRX2_MOUSE BRISC complex subunit Abraxas 2 OS=Mus musculus OX=10090 GN=Abraxas2 PE=1 SV=1
19	Q7TNF8	2.0	32.7	1846	0.078	0.013	RIMB1_MOUSE Peripheral-type benzodiazepine receptor-associated protein 1 OS=Mus musculus OX=10090 GN=Tspoap1 PE=2 SV=2
20	E0CXK2	2.2	32.7	1835	0.052	0.009	E0CXK2_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1i PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10713 DUF2509	4.9e+02	12.2	Protein of unknown function (DUF2509)
2	PF05485 THAP	1.3e-11	56.5	THAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000215742

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000304689	0.877	THAP domain-containing protein 11
2	9606.ENSP00000361777	0.861	Protein SET
3	9606.ENSP00000263663	0.795	TATA box-binding protein-associated factor RNA polymerase I subunit B
4	9606.ENSP00000254250	0.789	THAP domain-containing protein 1
5	9606.ENSP00000255882	0.783	Phosphatidylinositol 4-kinase alpha
6	9606.ENSP00000215730	0.767	Synaptosomal-associated protein 29
7	9606.ENSP00000372390	0.762	Cationic amino acid transporter 4
8	9606.ENSP00000341351	0.759	DDB1- and CUL4-associated factor 5
9	9606.ENSP00000346300	0.757	Crk-like protein
10	9606.ENSP00000260045	0.725	52 kDa repressor of the inhibitor of the protein kinase
11	9606.ENSP00000215727	0.723	Heparin cofactor 2
12	9606.ENSP00000382120	0.715	Apoptosis-inducing factor 3
13	9606.ENSP00000331682	0.700	Kelch-like protein 22
14	9606.ENSP00000215739	0.692	Leucine-zipper-like transcriptional regulator 1
15	9606.ENSP00000268712	0.635	Nuclear receptor corepressor 1
16	9606.ENSP00000483077	0.620	Zinc finger protein 74
17	9606.ENSP00000436848	0.614	LBH domain-containing protein 1
18	9606.ENSP00000249861	0.601	THAP domain containing 10
19	9606.ENSP00000229328	0.600	5'-AMP-activated protein kinase subunit beta-1
20	9606.ENSP00000477564	0.599	Scavenger receptor class F member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.992	enzyme binding
GO:0042802	0.991	identical protein binding
GO:0140033	0.976	acetylation-dependent protein binding
GO:0001222	0.976	transcription corepressor binding
GO:0035064	0.976	methylated histone binding
GO:0070577	0.972	lysine-acetylated histone binding
GO:0042826	0.970	histone deacetylase binding
GO:0140296	0.960	general transcription initiation factor binding
GO:0019904	0.955	protein domain specific binding
GO:0070742	0.878	C2H2 zinc finger domain binding
GO:0106153	0.878	phosphorylated histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0006357	0.977	regulation of transcription by RNA polymerase II
GO:0031400	0.968	negative regulation of protein modification process
GO:0031056	0.966	regulation of histone modification
GO:0045892	0.956	negative regulation of DNA-templated transcription
GO:1901983	0.946	regulation of protein acetylation
GO:2000756	0.944	regulation of peptidyl-lysine acetylation
GO:0000122	0.932	negative regulation of transcription by RNA polymerase II
GO:0035065	0.875	regulation of histone acetylation
GO:0031057	0.875	negative regulation of histone modification
GO:1901984	0.856	negative regulation of protein acetylation
GO:0009987	0.416	cellular process
GO:0008152	0.368	metabolic process
GO:0071704	0.352	organic substance metabolic process
GO:0044238	0.315	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0012505	0.999	endomembrane system
GO:0005694	0.997	chromosome
GO:0031090	0.995	organelle membrane
GO:0016604	0.994	nuclear body
GO:0000785	0.993	chromatin
GO:0031965	0.993	nuclear membrane
GO:0016607	0.981	nuclear speck
GO:0005737	0.935	cytoplasm
GO:0032991	0.906	protein-containing complex
GO:0005829	0.538	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]