StarFunc result for job id Q9BT67

User Input

>input (221 residues)
MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESG
FPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFML
TFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWL
WWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5U2S1	0.877	0.877	1.550E-31	221	0.977	0.977	Q5U2S1.pdb.gz	NFIP1_RAT NEDD4 family-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Ndfip1 PE=2 SV=1
2	AFDB:Q9NV92	0.478	0.323	4.568E-18	336	0.543	0.357	Q9NV92.pdb.gz	NFIP2_HUMAN NEDD4 family-interacting protein 2 OS=Homo sapiens OX=9606 GN=NDFIP2 PE=1 SV=2
3	AFDB:Q9VVJ5	0.451	0.380	3.060E-10	267	0.321	0.266	Q9VVJ5.pdb.gz	Q9VVJ5_DROME Nedd4 family interacting protein OS=Drosophila melanogaster OX=7227 GN=Ndfip PE=2 SV=1
4	AFDB:P38356	0.371	0.267	1.416E-5	321	0.226	0.156	P38356.pdb.gz	BSD2_YEAST Metal homeostatis protein BSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BSD2 PE=1 SV=1
5	AFDB:Q9P3T9	0.451	0.370	8.009E-5	277	0.217	0.173	Q9P3T9.pdb.gz	BSD2_SCHPO Probable metal homeostasis protein bsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bsd1 PE=3 SV=1
6	AFDB:C9J5N7	0.190	0.182	6.505E-2	233	0.127	0.120	C9J5N7.pdb.gz	C9J5N7_HUMAN Armadillo repeat containing 10 (Fragment) OS=Homo sapiens OX=9606 GN=ARMC10 PE=1 SV=1
7	PDB:6sswB	0.118	0.180	2.250E-1	140	0.113	0.179	6sswB.pdb.gz	Crystal structures of human MGST2 reveal synchronized conformational changes regulating catalysis.
8	AFDB:Q9LTX0	0.191	0.182	3.094E-1	238	0.109	0.101	Q9LTX0.pdb.gz	Q9LTX0_ARATH AT3g12650/T2E22_103 OS=Arabidopsis thaliana OX=3702 GN=T2E22.4 PE=1 SV=1
9	AFDB:Q9P3V0	0.145	0.097	3.094E-1	366	0.136	0.082	Q9P3V0.pdb.gz	WTF4_SCHPO Meiotic driver wtf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wtf4 PE=3 SV=2
10	AFDB:A0A482AQV2	0.140	0.095	4.129E-1	357	0.140	0.087	A0A482AQV2.pdb.gz	WTF9_SCHKA Meiotic driver wtf9 OS=Schizosaccharomyces kambucha OX=204045 GN=wtf9 PE=3 SV=1
11	PDB:5u0pG	0.214	0.235	5.350E-1	194	0.122	0.139	5u0pG.pdb.gz
12	AFDB:B1AC67	0.142	0.156	5.840E-1	192	0.095	0.109	B1AC67.pdb.gz	B1AC67_CHICK Relaxin 3 OS=Gallus gallus OX=9031 GN=RFLB PE=2 SV=1
13	PDB:6s7oH	0.191	0.311	6.005E-1	108	0.072	0.148	6s7oH.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
14	PDB:4ntaA	0.119	0.170	6.740E-1	147	0.122	0.184	4ntaA.pdb.gz
15	PDB:6vgcD	0.183	0.237	8.492E-1	155	0.090	0.129	6vgcD.pdb.gz	Structure-based, multi-targeted drug discovery approach to eicosanoid inhibition: Dual inhibitors of mPGES-1 and 5-lipoxygenase activating protein (FLAP).
16	PDB:2aczC	0.171	0.251	1.272	129	0.072	0.124	2aczC.pdb.gz	Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
17	PDB:7wffE	0.247	0.490	1.513	89	0.054	0.135	7wffE.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
18	PDB:6g2jK	0.245	0.449	2.140	98	0.086	0.194	6g2jK.pdb.gz	Cryo-EM structures of complex I from mouse heart mitochondria in two biochemically defined states.
19	PDB:6zgdA	0.204	0.165	2.267	288	0.063	0.049	6zgdA.pdb.gz
20	PDB:4bpmA	0.243	0.322	3.396	162	0.063	0.086	4bpmA.pdb.gz	Crystallizing Membrane Proteins in the Lipidic Mesophase. Experience with Human Prostaglandin E2 Synthase 1 and an Evolving Strategy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BT67	1.04e-162	449	221	1.000	1.000	NFIP1_HUMAN NEDD4 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=NDFIP1 PE=1 SV=1
2	Q8R0W6	2.21e-158	439	221	0.973	0.973	NFIP1_MOUSE NEDD4 family-interacting protein 1 OS=Mus musculus OX=10090 GN=Ndfip1 PE=1 SV=1
3	Q5U2S1	3.21e-158	438	221	0.977	0.977	NFIP1_RAT NEDD4 family-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Ndfip1 PE=2 SV=1
4	Q9NV92	1.92e-67	212	336	0.597	0.393	NFIP2_HUMAN NEDD4 family-interacting protein 2 OS=Homo sapiens OX=9606 GN=NDFIP2 PE=1 SV=2
5	Q9VVJ5	8.83e-27	105	267	0.235	0.195	Q9VVJ5_DROME Nedd4 family interacting protein OS=Drosophila melanogaster OX=7227 GN=Ndfip PE=2 SV=1
6	Q9P3T9	0.001	41.2	277	0.131	0.105	BSD2_SCHPO Probable metal homeostasis protein bsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bsd1 PE=3 SV=1
7	P38356	0.19	34.7	321	0.072	0.050	BSD2_YEAST Metal homeostatis protein BSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BSD2 PE=1 SV=1
8	F1M9H4	0.32	34.7	2574	0.072	0.006	F1M9H4_RAT HIVEP zinc finger 1 OS=Rattus norvegicus OX=10116 GN=Hivep1 PE=1 SV=3
9	Q3UHF7	1.5	32.3	2430	0.100	0.009	ZEP2_MOUSE Transcription factor HIVEP2 OS=Mus musculus OX=10090 GN=Hivep2 PE=1 SV=1
10	Q9ES82	1.7	32.0	367	0.127	0.076	POPD2_MOUSE Popeye domain-containing protein 2 OS=Mus musculus OX=10090 GN=Popdc2 PE=1 SV=1
11	Q00900	1.8	32.3	2437	0.100	0.009	ZEP2_RAT Human immunodeficiency virus type I enhancer-binding protein 2 homolog OS=Rattus norvegicus OX=10116 GN=Hivep2 PE=1 SV=2
12	M0R5D6	2.0	32.0	682	0.100	0.032	RN157_RAT E3 ubiquitin ligase Rnf157 OS=Rattus norvegicus OX=10116 GN=Rnf157 PE=2 SV=2
13	P31629	2.4	31.6	2446	0.081	0.007	ZEP2_HUMAN Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2
14	Q15361	2.4	31.6	905	0.127	0.031	TTF1_HUMAN Transcription termination factor 1 OS=Homo sapiens OX=9606 GN=TTF1 PE=1 SV=3
15	Q8C110	2.4	31.6	840	0.086	0.023	SLIK6_MOUSE SLIT and NTRK-like protein 6 OS=Mus musculus OX=10090 GN=Slitrk6 PE=1 SV=1
16	Q24139	3.4	30.8	370	0.068	0.041	COMM_DROME Protein commissureless 1 OS=Drosophila melanogaster OX=7227 GN=comm PE=1 SV=1
17	Q8SWT2	6.4	30.4	942	0.113	0.027	Q8SWT2_DROME GH12763p OS=Drosophila melanogaster OX=7227 GN=Rhau PE=1 SV=1
18	A0A0A0MQX1	7.2	30.4	2069	0.118	0.013	A0A0A0MQX1_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
19	Q9HD67	7.2	30.4	2058	0.118	0.013	MYO10_HUMAN Unconventional myosin-X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=3
20	E9PEW5	7.4	30.0	1397	0.118	0.019	E9PEW5_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15957 Comm	33	16.3	Commissureless
2	PF10176 DUF2370	3.7e-07	41.6	Protein of unknown function (DUF2370)
3	PF04534 Herpes_UL56	3.3e+02	12.2	Herpesvirus UL56 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000008577

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000008004	0.970	E3 ubiquitin-protein ligase
2	60711.ENSCSAP00000014174	0.868	Neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
3	60711.ENSCSAP00000000519	0.794	WW domain containing E3 ubiquitin protein ligase 2
4	60711.ENSCSAP00000013394	0.760	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
5	60711.ENSCSAP00000011507	0.696	HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1
6	60711.ENSCSAP00000009205	0.684	WW domain containing E3 ubiquitin protein ligase 1
7	60711.ENSCSAP00000008589	0.681	Ring finger protein 14
8	60711.ENSCSAP00000013752	0.680	ATPase, H+ transporting, lysosomal accessory protein 1
9	60711.ENSCSAP00000008281	0.672	Itchy E3 ubiquitin protein ligase
10	60711.ENSCSAP00000000389	0.651	SMAD specific E3 ubiquitin protein ligase 2
11	60711.ENSCSAP00000001728	0.583	NEDD4 binding protein 1
12	60711.ENSCSAP00000003303	0.571	Thyroid hormone receptor interactor 12
13	60711.ENSCSAP00000008147	0.565	Ubiquitin protein ligase E3 component n-recognin 5
14	60711.ENSCSAP00000002712	0.561	E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and transfers it to its substrates
15	60711.ENSCSAP00000007877	0.541	HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2
16	60711.ENSCSAP00000000134	0.531	N-ethylmaleimide sensitive factor, vesicle fusing ATPase
17	60711.ENSCSAP00000003218	0.527	Tumor suppressor. Acts as a dual-specificity protein phosphatase, dephosphorylating tyrosine-, serine- and threonine- phosphorylated proteins. Also acts as a lipid phosphatase.
18	60711.ENSCSAP00000001582	0.512	Proline rich Gla (G-carboxyglutamic acid) 4 (transmembrane)
19	60711.ENSCSAP00000002228	0.510	Solute carrier family 11 (proton-coupled divalent metal ion transporter), member 2
20	60711.ENSCSAP00000005109	0.506	Solute carrier family 11 (proton-coupled divalent metal ion transporter), member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019904	0.528	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0019222	0.993	regulation of metabolic process
GO:0050794	0.989	regulation of cellular process
GO:0051247	0.972	positive regulation of protein metabolic process
GO:0010468	0.953	regulation of gene expression
GO:0010605	0.945	negative regulation of macromolecule metabolic process
GO:0048583	0.927	regulation of response to stimulus
GO:0048523	0.925	negative regulation of cellular process
GO:0009987	0.920	cellular process
GO:0010629	0.900	negative regulation of gene expression
GO:0071704	0.846	organic substance metabolic process
GO:0048522	0.843	positive regulation of cellular process
GO:0044238	0.838	primary metabolic process
GO:0006807	0.819	nitrogen compound metabolic process
GO:0023051	0.792	regulation of signaling
GO:0010646	0.791	regulation of cell communication
GO:0009966	0.784	regulation of signal transduction
GO:0043170	0.730	macromolecule metabolic process
GO:1901564	0.706	organonitrogen compound metabolic process
GO:0044237	0.579	cellular metabolic process
GO:0065009	0.576	regulation of molecular function
GO:0032879	0.557	regulation of localization
GO:0019538	0.485	protein metabolic process
GO:0031323	0.478	regulation of cellular metabolic process
GO:0050896	0.466	response to stimulus
GO:0051234	0.438	establishment of localization
GO:0006810	0.433	transport
GO:0060341	0.428	regulation of cellular localization
GO:0009056	0.425	catabolic process
GO:0051049	0.395	regulation of transport
GO:1901575	0.392	organic substance catabolic process
GO:0023056	0.378	positive regulation of signaling
GO:0044092	0.367	negative regulation of molecular function
GO:0031401	0.366	positive regulation of protein modification process
GO:0032880	0.365	regulation of protein localization
GO:1902533	0.357	positive regulation of intracellular signal transduction
GO:0051051	0.346	negative regulation of transport
GO:0032409	0.338	regulation of transporter activity
GO:0009057	0.333	macromolecule catabolic process
GO:0044260	0.327	cellular macromolecule metabolic process
GO:0032410	0.326	negative regulation of transporter activity
GO:1901565	0.312	organonitrogen compound catabolic process
GO:0030163	0.302	protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0012505	0.998	endomembrane system
GO:0071944	0.990	cell periphery
GO:0031090	0.988	organelle membrane
GO:0005794	0.961	Golgi apparatus
GO:0098588	0.843	bounding membrane of organelle
GO:0005886	0.702	plasma membrane
GO:0048471	0.573	perinuclear region of cytoplasm
GO:0005829	0.469	cytosol
GO:0005938	0.385	cell cortex
GO:0031982	0.322	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]