StarFunc result for job id Q9BTA9

User Input

>input (647 residues)
MVMYARKQQRLSDGCHDRRGDSQPYQALKYSSKSHPSSGDHRHEKMRDAGDPSPPNKMLR
RSDSPENKYSDSTGHSKAKNVHTHRVRERDGGTSYSPQENSHNHSALHSSNSHSSNPSNN
PSKTSDAPYDSADDWSEHISSSGKKYYYNCRTEVSQWEKPKEWLEREQRQKEANKMAVNS
FPKDRDYRREVMQATATSGFASGMEDKHSSDASSLLPQNILSQTSRHNDRDYRLPRAETH
SSSTPVQHPIKPVVHPTATPSTVPSSPFTLQSDHQPKKSFDANGASTLSKLPTPTSSVPA
QKTERKESTSGDKPVSHSCTTPSTSSASGLNPTSAPPTSASAVPVSPVPQSPIPPLLQDP
NLLRQLLPALQATLQLNNSNVDISKINEVLTAAVTQASLQSIIHKFLTAGPSAFNITSLI
SQAAQLSTQAQPSNQSPMSLTSDASSPRSYVSPRISTPQTNTVPIKPLISTPPVSSQPKV
STPVVKQGPVSQSATQQPVTADKQQGHEPVSPRSLQRSSSQRSPSPGPNHTSNSSNASNA
TVVPQNSSARSTCSLTPALAAHFSENLIKHVQGWPADHAEKQASRLREEAHNMGTIHMSE
ICTELKNLRSLVRVCEIQATLREQRILFLRQQIKELEKLKNQNSFMV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BTA9	0.999	0.999	2.847E-87	647	1.000	1.000	Q9BTA9.pdb.gz	WAC_HUMAN WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC PE=1 SV=3
2	AFDB:B6EUA9	0.063	0.044	9.304E-4	958	0.133	0.090	B6EUA9.pdb.gz	PR40A_ARATH Pre-mRNA-processing protein 40A OS=Arabidopsis thaliana OX=3702 GN=PRP40A PE=1 SV=1
3	AFDB:F5H578	0.074	0.097	1.772E-3	463	0.117	0.164	F5H578.pdb.gz	F5H578_HUMAN Pre-mRNA processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A PE=1 SV=4
4	AFDB:Q9V3C4	0.060	0.049	3.664E-2	1028	0.125	0.079	Q9V3C4.pdb.gz	Q9V3C4_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=Gem3 PE=1 SV=1
5	AFDB:Q57YC3	0.069	0.049	4.168E-2	956	0.193	0.131	Q57YC3.pdb.gz	Q57YC3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.13M20.180 PE=4 SV=1
6	AFDB:Q19787	0.082	0.088	5.752E-2	599	0.117	0.127	Q19787.pdb.gz	BED3_CAEEL Zinc finger BED domain-containing protein 3 OS=Caenorhabditis elegans OX=6239 GN=bed-3 PE=1 SV=1
7	AFDB:O94900	0.058	0.069	9.633E-2	526	0.148	0.183	O94900.pdb.gz	TOX_HUMAN Thymocyte selection-associated high mobility group box protein TOX OS=Homo sapiens OX=9606 GN=TOX PE=1 SV=3
8	AFDB:Q90623	0.086	0.058	1.613E-1	1004	0.150	0.097	Q90623.pdb.gz	MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus OX=9031 GN=PPP1R12A PE=1 SV=1
9	AFDB:Q8CHY6	0.065	0.067	1.720E-1	629	0.125	0.129	Q8CHY6.pdb.gz	P66A_MOUSE Transcriptional repressor p66 alpha OS=Mus musculus OX=10090 GN=Gatad2a PE=1 SV=2
10	PDB:7kkfA	0.046	0.163	1.809E-1	162	0.020	0.080	7kkfA.pdb.gz
11	AFDB:F4JP43	0.069	0.030	2.701E-1	2037	0.158	0.050	F4JP43.pdb.gz	F4JP43_ARATH G2484-1 protein OS=Arabidopsis thaliana OX=3702 GN=G2484-1 PE=1 SV=1
12	PDB:1yw5A	0.041	0.150	4.182E-1	177	0.015	0.056	1yw5A.pdb.gz
13	PDB:6y0fC	0.040	0.035	2.541	722	0.012	0.011	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
14	PDB:2c5uA	0.024	0.040	2.890	375	0.011	0.019	2c5uA.pdb.gz	Molecular Architecture and Ligand Recognition Determinants for T4 RNA Ligase
15	PDB:6rlbD	0.048	0.065	5.162	446	0.031	0.045	6rlbD.pdb.gz
16	PDB:4wjlB	0.036	0.033	5.506	719	0.008	0.007	4wjlB.pdb.gz
17	PDB:6jcxF	0.062	0.181	5.506	186	0.020	0.070	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
18	PDB:7f5yB	0.021	0.112	5.506	120	0.008	0.042	7f5yB.pdb.gz
19	PDB:4dteA	0.022	0.037	6.680	374	0.006	0.011	4dteA.pdb.gz
20	PDB:2z4hB	0.024	0.077	7.599	194	0.009	0.031	2z4hB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRT2	0.0	662	495	0.519	0.679	A0A0A0MRT2_HUMAN WW domain containing adaptor with coiled-coil OS=Homo sapiens OX=9606 GN=WAC PE=1 SV=1
2	Q924H7	0.0	1221	646	0.951	0.952	WAC_MOUSE WW domain-containing adapter protein with coiled-coil OS=Mus musculus OX=10090 GN=Wac PE=1 SV=2
3	Q9BTA9	0.0	1316	647	1.000	1.000	WAC_HUMAN WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC PE=1 SV=3
4	C9JVK6	1.11e-123	365	173	0.267	1.000	C9JVK6_HUMAN WW domain-containing adapter protein with coiled-coil (Fragment) OS=Homo sapiens OX=9606 GN=WAC PE=1 SV=1
5	Q9VX88	2.04e-21	101	834	0.070	0.054	WAC_DROME WW domain-containing adapter protein with coiled-coil homolog OS=Drosophila melanogaster OX=7227 GN=wcy PE=2 SV=2
6	B6EUA9	1.10e-05	51.2	958	0.032	0.022	PR40A_ARATH Pre-mRNA-processing protein 40A OS=Arabidopsis thaliana OX=3702 GN=PRP40A PE=1 SV=1
7	Q6AWW6	1.07e-04	47.8	512	0.031	0.039	Q6AWW6_ARATH At2g47310 OS=Arabidopsis thaliana OX=3702 GN=At2g47310 PE=1 SV=1
8	F4JCC1	1.44e-04	47.8	992	0.034	0.022	PR40B_ARATH Pre-mRNA-processing protein 40B OS=Arabidopsis thaliana OX=3702 GN=PRP40B PE=1 SV=1
9	B8BCZ8	5.73e-04	45.4	738	0.026	0.023	FCA_ORYSI Flowering time control protein FCA OS=Oryza sativa subsp. indica OX=39946 GN=FCA PE=3 SV=2
10	Q6K271	5.88e-04	45.4	738	0.026	0.023	FCA_ORYSJ Flowering time control protein FCA OS=Oryza sativa subsp. japonica OX=39947 GN=FCA PE=1 SV=1
11	Q8CGF7	8.61e-04	45.1	1100	0.028	0.016	TCRG1_MOUSE Transcription elongation regulator 1 OS=Mus musculus OX=10090 GN=Tcerg1 PE=1 SV=2
12	H0YG38	0.003	42.7	367	0.032	0.057	H0YG38_HUMAN Pre-mRNA processing factor 40 homolog A (Fragment) OS=Homo sapiens OX=9606 GN=PRPF40A PE=1 SV=2
13	Q8IDB7	0.003	43.1	509	0.023	0.029	Q8IDB7_PLAF7 CUGBP Elav-like family member 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1359400 PE=4 SV=1
14	Q9LT25	0.006	42.4	835	0.065	0.050	PR40C_ARATH Pre-mRNA-processing protein 40C OS=Arabidopsis thaliana OX=3702 GN=PRP40C PE=1 SV=1
15	F5H578	0.010	41.6	972	0.026	0.017	F5H578_HUMAN Pre-mRNA processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A PE=1 SV=4
16	O75400	0.010	41.6	957	0.026	0.018	PR40A_HUMAN Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A PE=1 SV=2
17	Q9R1C7	0.011	41.6	953	0.026	0.018	PR40A_MOUSE Pre-mRNA-processing factor 40 homolog A OS=Mus musculus OX=10090 GN=Prpf40a PE=1 SV=1
18	O14776	0.019	40.8	1098	0.023	0.014	TCRG1_HUMAN Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1 PE=1 SV=2
19	P33203	0.042	39.3	583	0.026	0.029	PRP40_YEAST Pre-mRNA-processing protein PRP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP40 PE=1 SV=1
20	Q6NWY9	0.073	38.9	871	0.022	0.016	PR40B_HUMAN Pre-mRNA-processing factor 40 homolog B OS=Homo sapiens OX=9606 GN=PRPF40B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07028 DUF1319	6.5e+02	11.9	Protein of unknown function (DUF1319)
2	PF00397 WW	3.3e-06	38.4	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346986

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261973	0.971	RNA-binding protein 25
2	9606.ENSP00000373772	0.945	E3 ubiquitin-protein ligase BRE1A
3	9606.ENSP00000325677	0.895	E3 ubiquitin-protein ligase BRE1B
4	9606.ENSP00000360532	0.817	Cell division cycle 5-like protein
5	9606.ENSP00000360613	0.779	Ubiquitin-conjugating enzyme E2 A
6	9606.ENSP00000472998	0.739	U1 small nuclear ribonucleoprotein 70 kDa
7	9606.ENSP00000415433	0.733	Integrator complex subunit 12
8	9606.ENSP00000309031	0.729	Deubiquitinating protein VCIP135
9	9606.ENSP00000403310	0.720	Small nuclear ribonucleoprotein U11/U12 subunit 35
10	9606.ENSP00000348010	0.704	Pre-mRNA-processing factor 39
11	9606.ENSP00000265339	0.703	Ubiquitin-conjugating enzyme E2 B
12	9606.ENSP00000244020	0.694	Serine/arginine-rich splicing factor 6
13	9606.ENSP00000299601	0.688	RNA polymerase-associated protein LEO1
14	9606.ENSP00000282516	0.666	Nipped-B-like protein
15	9606.ENSP00000355013	0.665	RNA polymerase-associated protein CTR9 homolog
16	9606.ENSP00000400591	0.662	Small nuclear ribonucleoprotein E
17	9606.ENSP00000357196	0.655	Receptor-type tyrosine-protein phosphatase kappa
18	9606.ENSP00000351492	0.651	Ubiquitin-like protein 5
19	9606.ENSP00000262043	0.650	PHD finger protein 3
20	9606.ENSP00000356405	0.650	Parafibromin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	1.000	chromatin binding
GO:0000993	1.000	RNA polymerase II complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0044238	0.984	primary metabolic process
GO:0010604	0.980	positive regulation of macromolecule metabolic process
GO:0006807	0.979	nitrogen compound metabolic process
GO:0043170	0.976	macromolecule metabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0019219	0.963	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.956	negative regulation of biological process
GO:0010564	0.955	regulation of cell cycle process
GO:1901987	0.950	regulation of cell cycle phase transition
GO:0010468	0.949	regulation of gene expression
GO:0031325	0.949	positive regulation of cellular metabolic process
GO:0051173	0.947	positive regulation of nitrogen compound metabolic process
GO:0051252	0.944	regulation of RNA metabolic process
GO:0048523	0.937	negative regulation of cellular process
GO:0051246	0.924	regulation of protein metabolic process
GO:0010605	0.922	negative regulation of macromolecule metabolic process
GO:0051172	0.912	negative regulation of nitrogen compound metabolic process
GO:0006355	0.910	regulation of DNA-templated transcription
GO:0050896	0.887	response to stimulus
GO:0031324	0.856	negative regulation of cellular metabolic process
GO:0045786	0.817	negative regulation of cell cycle
GO:0007346	0.794	regulation of mitotic cell cycle
GO:1901988	0.787	negative regulation of cell cycle phase transition
GO:0045930	0.778	negative regulation of mitotic cell cycle
GO:0036211	0.773	protein modification process
GO:1901990	0.772	regulation of mitotic cell cycle phase transition
GO:1902806	0.755	regulation of cell cycle G1/S phase transition
GO:0051716	0.681	cellular response to stimulus
GO:0044237	0.576	cellular metabolic process
GO:0045935	0.546	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.505	positive regulation of RNA metabolic process
GO:0007154	0.498	cell communication
GO:0007165	0.483	signal transduction
GO:0006950	0.473	response to stress
GO:0016570	0.465	histone modification
GO:0070647	0.459	protein modification by small protein conjugation or removal
GO:0016567	0.453	protein ubiquitination
GO:0010557	0.427	positive regulation of macromolecule biosynthetic process
GO:0031328	0.425	positive regulation of cellular biosynthetic process
GO:0045893	0.424	positive regulation of DNA-templated transcription
GO:0033554	0.421	cellular response to stress
GO:0022402	0.410	cell cycle process
GO:0009894	0.400	regulation of catabolic process
GO:0006974	0.397	cellular response to DNA damage stimulus
GO:0031329	0.392	regulation of cellular catabolic process
GO:0016574	0.380	histone ubiquitination
GO:1903047	0.361	mitotic cell cycle process
GO:0035556	0.355	intracellular signal transduction
GO:2000045	0.324	regulation of G1/S transition of mitotic cell cycle
GO:0010506	0.322	regulation of autophagy
GO:1901991	0.322	negative regulation of mitotic cell cycle phase transition
GO:0051248	0.310	negative regulation of protein metabolic process
GO:0044774	0.308	mitotic DNA integrity checkpoint signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.986	protein-containing complex
GO:1990904	0.948	ribonucleoprotein complex
GO:0140513	0.886	nuclear protein-containing complex
GO:0005681	0.850	spliceosomal complex
GO:0005737	0.617	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]