StarFunc result for job id Q9BTC0

User Input

>input (2240 residues)
MDDKGDPSNEEAPKAIKPTSKEFRKTWGFRRTTIAKREGAGDAEADPLEPPPPQQQLGLS
LRRSGRQPKRTERVEQFLTIARRRGRRSMPVSLEDSGEPTSCPATDAETASEGSVESASE
TRSGPQSASTAVKERPASSEKVKGGDDHDDTSDSDSDGLTLKELQNRLRRKREQEPTERP
LKGIQSRLRKKRREEGPAETVGSEASDTVEGVLPSKQEPENDQGVVSQAGKDDRESKLEG
KAAQDIKDEEPGDLGRPKPECEGYDPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGIS
EARGRLLERNGEDYICPNCTILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKS
SEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILK
HAAATMKFLSSGKEQKPKPKEKMKMKPEKPSLPKCGAQAGIKISSVHKRPAPEKKETTVK
KAVVVPARSEALGKEAACESSTPSWASDHNYNAVKPEKTAAPSPSLLYKSTKEDRRSEEK
AAAMAASKKTAPPGSAVGKQPAPRNLVPKKSSFANVAAATPAIKKPPSGFKGTIPKRPWL
SATPSSGASAARQAGPAPAAATAASKKFPGSAALVGAVRKPVVPSVPMASPAPGRLGAMS
AAPSQPNSQIRQNIRRSLKEILWKRVNDSDDLIMTENEVGKIALHIEKEMFNLFQVTDNR
YKSKYRSIMFNLKDPKNQGLFHRVLREEISLAKLVRLKPEELVSKELSTWKERPARSVME
SRTKLHNESKKTAPRQEAIPDLEDSPPVSDSEEQQESARAVPEKSTAPLLDVFSSMLKDT
TSQHRAHLFDLNCKICTGQVPSAEDEPAPKKQKLSASVKKEDLKSKHDSSAPDPAPDSAD
EVMPEAVPEVASEPGLESASHPNVDRTYFPGPPGDGHPEPSPLEDLSPCPASCGSGVVTT
VTVSGRDPRTAPSSSCTAVASAASRPDSTHMVEARQDVPKPVLTSVMVPKSILAKPSSSP
DPRYLSVPPSPNISTSESRSPPEGDTTLFLSRLSTIWKGFINMQSVAKFVTKAYPVSGCF
DYLSEDLPDTIHIGGRIAPKTVWDYVGKLKSSVSKELCLIRFHPATEEEEVAYISLYSYF
SSRGRFGVVANNNRHVKDLYLIPLSAQDPVPSKLLPFEGPGLESPRPNIILGLVICQKIK
RPANSGELDKMDEKRTRLQPEEADVPAYPKVATVPQSEKKPSKYPLCSADAAVSTTPPGS
PPPPPPLPEPPVLKVLSSLKPAAPSPATAATTAAAASTAASSTASSASKTASPLEHILQT
LFGKKKSFDPSAREPPGSTAGLPQEPKTTAEDGVPAPPLLDPIVQQFGQFSKDKALEEEE
DDRPYDPEEEYDPERAFDTQLVERGRRHEVERAPEAAAAEREEVAYDPEDETILEEAKVT
VDDLPNRMCADVRRNSVERPAEPVAGAATPSLVEQQKMLEELNKQIEEQKRQLEEQEEAL
RQQRAAVGVSMAHFSVSDALMSPPPKSSLPKAELFQQEQQSADKPASLPPASQASNHRDP
RQARRLATETGEGEGEPLSRLSARGAQGALPERDASRGGLVGQAPMPVPEEKEPASSPWA
SGEKPPAGSEQDGWKAEPGEGTRPATVGDSSARPARRVLLPTPPCGALQPGFPLQHDGER
DPFTCPGFASQDKALGSAQYEDPRNLHSAGRSSSPAGETEGDREPQARPGEGTAPLPPPG
QKVGGSQPPFQGQREPGPHALGMSGLHGPNFPGPRGPAPPFPEENIASNDGPRGPPPARF
GAQKGPIPSLFSGQHGPPPYGDSRGPSPSYLGGPRGVAPSQFEERKDPHGEKREFQDAPY
NEVTGAPAQFEGTEQAPFLGSRGGAPFQFGGQRRPLLSQLKGPRGGPPPSQFGGQRGPPP
GHFVGPRGPHPSQFETARGPHPNQFEGPRGQAPNFMPGPRGIQPQQFEDQRVHSPPRFTN
QRAPAPLQFGGLRGSAPFSEKNEQTPSRFHFQGQAPQVMKPGPRPLLELPSHPPQHRKDR
WEEAGPPSALSSSAPGQGPEADGQWASADFREGKGHEYRNQTFEGRQRERFDVGPKEKPL
EEPDAQGRASEDRRRERERGRNWSRERDWDRPREWDRHRDKDSSRDWDRNRERSANRDRE
READRGKEWDRSRERSRNRERERDRRRDRDRSRSRERDRDKARDRERGRDRKDRSKSKES
ARDPKPEASRASDAGTASQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C9B9	0.173	0.172	0.000	2256	0.746	0.741	Q8C9B9.pdb.gz	DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus OX=10090 GN=Dido1 PE=1 SV=4
2	AFDB:Q9BTC0	0.999	0.999	0.000	2240	1.000	1.000	Q9BTC0.pdb.gz	DIDO1_HUMAN Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5
3	AFDB:Q9VUQ9	0.038	0.040	1.848E-8	2139	0.125	0.131	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
4	AFDB:F4KE59	0.055	0.086	2.877E-8	1311	0.086	0.147	F4KE59.pdb.gz	PAIP2_ARATH Protein PARALOG OF AIPP2 OS=Arabidopsis thaliana OX=3702 GN=PAIPP2 PE=1 SV=1
5	AFDB:P35658	0.029	0.031	2.937E-7	2090	0.120	0.129	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
6	AFDB:A0A0G2K916	0.032	0.029	7.116E-7	2615	0.129	0.111	A0A0G2K916.pdb.gz	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
7	AFDB:E9QEX9	0.027	0.026	1.171E-6	2607	0.123	0.106	E9QEX9.pdb.gz	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
8	AFDB:Q8WYB5	0.035	0.036	3.539E-6	2073	0.123	0.133	Q8WYB5.pdb.gz	KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens OX=9606 GN=KAT6B PE=1 SV=3
9	AFDB:F4I1T7	0.033	0.036	4.178E-6	1819	0.118	0.146	F4I1T7.pdb.gz	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1
10	AFDB:Q8IZD2	0.036	0.041	4.666E-6	1858	0.134	0.162	Q8IZD2.pdb.gz	KMT2E_HUMAN Inactive histone-lysine N-methyltransferase 2E OS=Homo sapiens OX=9606 GN=KMT2E PE=1 SV=1
11	PDB:5iy6U	0.050	0.565	1.434E-4	170	0.015	0.200	5iy6U.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
12	PDB:5z8lA	0.021	0.221	1.266E-2	204	0.008	0.088	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
13	PDB:7nfcC	0.036	0.147	4.775E-2	477	0.010	0.046	7nfcC.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
14	PDB:4bxzX	0.043	0.675	5.047E-2	113	0.013	0.257	4bxzX.pdb.gz	Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
15	PDB:6zheC	0.035	0.100	1.444E-1	705	0.010	0.031	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
16	PDB:5v8fE	0.033	0.141	2.804E-1	422	0.008	0.043	5v8fE.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
17	PDB:7k0yC	0.040	0.123	2.804E-1	655	0.010	0.034	7k0yC.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
18	PDB:5yfgA	0.023	0.147	3.697E-1	186	0.006	0.070	5yfgA.pdb.gz
19	PDB:5iv5BE	0.027	0.208	4.364E-1	165	0.007	0.097	5iv5BE.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
20	PDB:6sgaFS	0.026	0.124	6.427E-1	277	0.008	0.065	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C9B9	0.0	2942	2256	0.726	0.721	DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus OX=10090 GN=Dido1 PE=1 SV=4
2	Q9BTC0	0.0	4517	2240	1.000	1.000	DIDO1_HUMAN Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5
3	B1ASB6	6.13e-27	122	1015	0.039	0.087	SPOC1_MOUSE SPOC domain-containing protein 1 OS=Mus musculus OX=10090 GN=Spocd1 PE=1 SV=3
4	A0A0B4K6G3	4.01e-23	110	2018	0.030	0.034	A0A0B4K6G3_DROME Protein partner of snf, isoform B OS=Drosophila melanogaster OX=7227 GN=pps PE=1 SV=1
5	Q9VG78	4.15e-23	110	2016	0.030	0.033	Q9VG78_DROME Protein partner of snf, isoform A OS=Drosophila melanogaster OX=7227 GN=pps PE=1 SV=1
6	Q9Y7V2	9.88e-14	79.3	721	0.027	0.083	BYE1_SCHPO Transcription factor bye1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bye1 PE=3 SV=3
7	F1QBY1	2.54e-12	75.5	2876	0.021	0.017	NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio OX=7955 GN=nipblb PE=2 SV=1
8	Q9W0T1	5.35e-12	74.3	2669	0.011	0.009	NU301_DROME Nucleosome-remodeling factor subunit NURF301 OS=Drosophila melanogaster OX=7227 GN=E(bx) PE=1 SV=2
9	Q6ZMT4	5.77e-12	73.9	941	0.014	0.034	KDM7A_HUMAN Lysine-specific demethylase 7A OS=Homo sapiens OX=9606 GN=KDM7A PE=1 SV=2
10	Q6P9L3	1.07e-11	73.2	1114	0.011	0.022	Q6P9L3_MOUSE Bptf protein OS=Mus musculus OX=10090 GN=Bptf PE=2 SV=1
11	A0A8I6ALT2	1.09e-11	73.6	2974	0.012	0.009	A0A8I6ALT2_RAT Bromodomain PHD finger transcription factor OS=Rattus norvegicus OX=10116 GN=Bptf PE=1 SV=1
12	A0A8I6GFZ0	1.31e-11	73.2	2767	0.012	0.009	A0A8I6GFZ0_RAT Bromodomain PHD finger transcription factor OS=Rattus norvegicus OX=10116 GN=Bptf PE=1 SV=1
13	A0A0G2K7N8	1.32e-11	73.2	2894	0.012	0.009	A0A0G2K7N8_RAT Bromodomain PHD finger transcription factor OS=Rattus norvegicus OX=10116 GN=Bptf PE=1 SV=2
14	A0A8I6GLB4	1.38e-11	73.2	2982	0.011	0.008	A0A8I6GLB4_RAT Bromodomain PHD finger transcription factor OS=Rattus norvegicus OX=10116 GN=Bptf PE=1 SV=1
15	A0A8I5ZVH2	1.44e-11	73.2	3043	0.011	0.008	A0A8I5ZVH2_RAT Bromodomain PHD finger transcription factor OS=Rattus norvegicus OX=10116 GN=Bptf PE=1 SV=1
16	Q3TMJ3	2.33e-11	71.6	669	0.011	0.036	Q3TMJ3_MOUSE Bptf protein (Fragment) OS=Mus musculus OX=10090 GN=Bptf PE=2 SV=1
17	A0A2R8Y7Q1	2.84e-11	72.0	2965	0.011	0.008	A0A2R8Y7Q1_HUMAN Bromodomain PHD finger transcription factor (Fragment) OS=Homo sapiens OX=9606 GN=BPTF PE=1 SV=2
18	E9PE19	3.42e-11	71.6	2822	0.011	0.009	E9PE19_HUMAN Bromodomain PHD finger transcription factor (Fragment) OS=Homo sapiens OX=9606 GN=BPTF PE=1 SV=4
19	Q12830	3.63e-11	71.6	3046	0.011	0.008	BPTF_HUMAN Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens OX=9606 GN=BPTF PE=1 SV=3
20	E7ETD6	4.14e-11	71.6	2764	0.011	0.009	E7ETD6_HUMAN Bromodomain PHD finger transcription factor (Fragment) OS=Homo sapiens OX=9606 GN=BPTF PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00628 PHD	1.1e-07	42.9	PHD-finger
2	PF04102 SlyX	40	16.3	SlyX
3	PF07744 SPOC	2.6e-24	97.3	SPOC domain
4	PF07500 TFIIS_M	2.6e-23	94.0	Transcription factor S-II (TFIIS), central domain
5	PF15446 zf-PHD-like	8.9e+02	10.8	PHD/FYVE-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000266070

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000476960	0.953	Histone cluster 2 H3 pseudogene 2
2	9606.ENSP00000352252	0.891	Histone cluster 1 H3 family member j
3	9606.ENSP00000480826	0.887	Histone cluster 1 H3 family member a
4	9606.ENSP00000358160	0.882	Histone cluster 1 H3 family member h
5	9606.ENSP00000483283	0.882	Histone cluster 1 H3 family member i
6	9606.ENSP00000484095	0.882	Histone cluster 1 H3 family member f
7	9606.ENSP00000484638	0.882	Histone cluster 1 H3 family member g
8	9606.ENSP00000484841	0.882	Histone H3.1
9	9606.ENSP00000366999	0.879	Histone cluster 1 H3 family member d
10	9606.ENSP00000482271	0.879	Histone cluster 1 H3 family member e
11	9606.ENSP00000484658	0.879	Histone cluster 1 H3 family member c
12	9606.ENSP00000385479	0.876	Histone H3.2
13	9606.ENSP00000333277	0.875	Histone cluster 2 H3 family member d
14	9606.ENSP00000355778	0.875	Histone H3.3
15	9606.ENSP00000358154	0.875	Histone cluster 2 H3 family member c
16	9606.ENSP00000254810	0.873	H3 histone, family 3B (H3.3B)
17	9606.ENSP00000339835	0.873	Histone H3.3C
18	9606.ENSP00000355657	0.873	Histone H3.1t
19	9606.ENSP00000348056	0.831	SUMO-conjugating enzyme UBC9
20	9606.ENSP00000480158	0.830	DNA-directed RNA polymerase II subunit RPB1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.896	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0050896	0.925	response to stimulus
GO:0051716	0.873	cellular response to stimulus
GO:0008219	0.866	cell death
GO:0007154	0.818	cell communication
GO:0023052	0.812	signaling
GO:0012501	0.795	programmed cell death
GO:0007165	0.760	signal transduction
GO:0006915	0.665	apoptotic process
GO:0019222	0.563	regulation of metabolic process
GO:0051171	0.529	regulation of nitrogen compound metabolic process
GO:0080090	0.482	regulation of primary metabolic process
GO:0060255	0.480	regulation of macromolecule metabolic process
GO:0031323	0.469	regulation of cellular metabolic process
GO:0008152	0.387	metabolic process
GO:0044238	0.382	primary metabolic process
GO:0019219	0.382	regulation of nucleobase-containing compound metabolic process
GO:0097190	0.372	apoptotic signaling pathway
GO:0051252	0.346	regulation of RNA metabolic process
GO:0048518	0.321	positive regulation of biological process
GO:0010468	0.319	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.999	cytoplasm
GO:0032991	0.458	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]