StarFunc result for job id Q9BTC8

User Input

>input (594 residues)
MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLAD
KHAKEIEEESETTVEADLTDKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESV
LSYLDKEDTFFYSLVYDPSLKTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVK
VWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDT
LYRHSYDLSSAISVLVPLGGPVLCRDEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPW
KSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQISTSNGKPGAV
NGAVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCAICWLYWKKYGGLKMPT
QSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFAR
QVCKNTLRLRQAARRPFVAINYAAIRAEYADRHAELSGSPLKSKSTRKPLACIIGYLEIH
PAKKPNVIRSTPSLQTPTTKRMLTTPNHTSLSILGKRNYSHHNGLDELTCCVSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BTC8	1.000	1.000	0.000	594	1.000	1.000	Q9BTC8.pdb.gz	MTA3_HUMAN Metastasis-associated protein MTA3 OS=Homo sapiens OX=9606 GN=MTA3 PE=1 SV=2
2	AFDB:E7EY65	0.596	0.511	1.534E-83	709	0.742	0.622	E7EY65.pdb.gz	E7EY65_DANRE Metastasis-associated 1 family, member 3 OS=Danio rerio OX=7955 GN=fj99h01 PE=1 SV=1
3	AFDB:F1QLG2	0.698	0.629	6.893E-80	663	0.631	0.566	F1QLG2.pdb.gz	F1QLG2_DANRE Metastasis-associated 1 family, member 2 OS=Danio rerio OX=7955 GN=wu:fd61b05 PE=1 SV=2
4	AFDB:A0A024R534	0.744	0.668	1.253E-78	668	0.646	0.575	A0A024R534.pdb.gz
5	AFDB:Q13330	0.539	0.460	3.358E-78	715	0.700	0.582	Q13330.pdb.gz	MTA1_HUMAN Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=2
6	AFDB:O61907	0.547	0.333	2.217E-42	1022	0.382	0.222	O61907.pdb.gz	O61907_CAEEL DIOX_N domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lin-40 PE=1 SV=2
7	PDB:7aoaD	0.272	0.465	4.588E-42	343	0.441	0.764	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
8	AFDB:Q9P2R6	0.367	0.172	1.931E-30	1566	0.244	0.093	Q9P2R6.pdb.gz	RERE_HUMAN Arginine-glutamic acid dipeptide repeats protein OS=Homo sapiens OX=9606 GN=RERE PE=1 SV=2
9	AFDB:Q05GC8	0.208	0.111	2.424E-7	1220	0.148	0.072	Q05GC8.pdb.gz	Q05GC8_HUMAN Breast cancer anti-estrogen resistance 2 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
10	AFDB:Q7Z3K6	0.223	0.239	6.132E-7	550	0.130	0.140	Q7Z3K6.pdb.gz	MIER3_HUMAN Mesoderm induction early response protein 3 OS=Homo sapiens OX=9606 GN=MIER3 PE=1 SV=2
11	AFDB:Q8N108	0.225	0.257	1.230E-6	512	0.126	0.146	Q8N108.pdb.gz	MIER1_HUMAN Mesoderm induction early response protein 1 OS=Homo sapiens OX=9606 GN=MIER1 PE=1 SV=2
12	PDB:5z8lA	0.149	0.415	6.437E-6	204	0.044	0.127	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
13	PDB:5l3cB	0.091	0.355	3.442E-2	134	0.052	0.231	5l3cB.pdb.gz	LSD1/KDM1A mutations associated to a newly described form of intellectual disability impair demethylase activity and binding to transcription factors.
14	PDB:4czzB	0.090	0.355	5.474E-2	133	0.047	0.211	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
15	PDB:6lthO	0.081	0.143	7.752E-2	325	0.042	0.077	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
16	PDB:7vdvW	0.080	0.182	1.648E-1	248	0.035	0.085	7vdvW.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
17	PDB:7vdvX	0.075	0.170	1.746E-1	252	0.045	0.107	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
18	PDB:5ikjA	0.087	0.113	3.502E-1	448	0.025	0.033	5ikjA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
19	PDB:6k15H	0.069	0.103	3.933E-1	393	0.022	0.033	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
20	PDB:2cjjA	0.079	0.642	4.960E-1	63	0.022	0.206	2cjjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	B2GV01	768	668	0.646	0.575	B2GV01_RAT Metastasis-associated gene family, member 2 OS=Rattus norvegicus OX=10116 GN=Mta2 PE=1 SV=1
2	B7Z0T5	572	853	0.498	0.347	B7Z0T5_DROME Metastasis associated 1-like, isoform C OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=1
3	E7EQY4	1060	514	0.854	0.986	E7EQY4_HUMAN Metastasis associated 1 family member 3 OS=Homo sapiens OX=9606 GN=MTA3 PE=1 SV=1
4	E7ESY4	819	703	0.707	0.597	E7ESY4_HUMAN Metastasis associated 1 OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=1
5	E7EY65	890	709	0.744	0.623	E7EY65_DANRE Metastasis-associated 1 family, member 3 OS=Danio rerio OX=7955 GN=fj99h01 PE=1 SV=1
6	F1QLG2	758	663	0.631	0.566	F1QLG2_DANRE Metastasis-associated 1 family, member 2 OS=Danio rerio OX=7955 GN=wu:fd61b05 PE=1 SV=2
7	F6RRE2	1121	537	0.904	1.000	F6RRE2_HUMAN Metastasis associated 1 family member 3 OS=Homo sapiens OX=9606 GN=MTA3 PE=1 SV=1
8	F7F888	763	670	0.646	0.573	F7F888_RAT Metastasis associated 1 family, member 2 OS=Rattus norvegicus OX=10116 GN=Mta2 PE=1 SV=1
9	H0Y4T7	530	511	0.449	0.523	H0Y4T7_HUMAN Metastasis associated 1 (Fragment) OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=1
10	O94776	768	668	0.646	0.575	MTA2_HUMAN Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1
11	Q13330	816	715	0.705	0.586	MTA1_HUMAN Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=2
12	Q62599	810	703	0.700	0.592	MTA1_RAT Metastasis-associated protein MTA1 OS=Rattus norvegicus OX=10116 GN=Mta1 PE=1 SV=1
13	Q6AWS2	572	857	0.498	0.345	Q6AWS2_DROME SD15071p OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=2 SV=1
14	Q7SXR7	754	631	0.628	0.591	Q7SXR7_DANRE Metastasis associated 1 family, member 2 OS=Danio rerio OX=7955 GN=wu:fi29g02 PE=1 SV=1
15	Q7ZUE1	842	517	0.690	0.793	Q7ZUE1_DANRE Metastasis associated family, member 3 OS=Danio rerio OX=7955 GN=wu:fj99h01 PE=1 SV=1
16	Q8K4B0	810	715	0.702	0.583	MTA1_MOUSE Metastasis-associated protein MTA1 OS=Mus musculus OX=10090 GN=Mta1 PE=1 SV=1
17	Q924K8	1148	591	0.929	0.934	MTA3_MOUSE Metastasis-associated protein MTA3 OS=Mus musculus OX=10090 GN=Mta3 PE=1 SV=1
18	Q9BTC8	1246	594	1.000	1.000	MTA3_HUMAN Metastasis-associated protein MTA3 OS=Homo sapiens OX=9606 GN=MTA3 PE=1 SV=2
19	Q9R190	770	668	0.648	0.576	MTA2_MOUSE Metastasis-associated protein MTA2 OS=Mus musculus OX=10090 GN=Mta2 PE=1 SV=1
20	Q9VNF7	589	844	0.512	0.360	Q9VNF7_DROME Metastasis associated 1-like, isoform B OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01426 BAH	2e-28	110.1	BAH domain
2	PF01448 ELM2	4.6e-13	61.0	ELM2 domain
3	PF00320 GATA	6.6e-06	36.9	GATA zinc finger
4	PF17226 MTA_R1	1.7e-25	100.4	MTA R1 domain
5	PF00249 Myb_DNA-binding	0.022	26.3	Myb-like DNA-binding domain
6	PF15963 Myb_DNA-bind_7	53	15.1	Myb DNA-binding like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010380895.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010385015.1	0.973	GATA zinc finger domain containing 2A
2	61622.XP_010367558.1	0.968	RB binding protein 7, chromatin remodeling factor
3	61622.XP_010373251.1	0.968	methyl-CpG-binding domain protein 3
4	61622.XP_010384237.1	0.968	chromodomain-helicase-DNA-binding protein 4 isoform X1
5	61622.XP_010355152.1	0.967	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
6	61622.XP_010352478.1	0.954	RB binding protein 4, chromatin remodeling factor
7	61622.XP_010363053.1	0.952	GATA zinc finger domain containing 2B
8	61622.XP_010352359.1	0.935	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
9	61622.XP_010380663.1	0.935	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
10	61622.XP_010360702.1	0.932	chromodomain-helicase-DNA-binding protein 3 isoform X1
11	61622.XP_010355710.1	0.929	chromodomain-helicase-DNA-binding protein 5
12	61622.XP_010383197.1	0.926	Metastasis-associated protein MTA2
13	61622.XP_010375257.1	0.923	Metastasis associated 1
14	61622.XP_010373660.1	0.922	methyl-CpG-binding domain protein 2
15	61622.XP_010366685.1	0.873	Cyclin-dependent kinase 2-associated protein 1 isoform X1
16	61622.XP_010387152.1	0.857	methyl-CpG-binding domain protein 3-like 1
17	61622.XP_010386548.1	0.838	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4), and some other non-histone substrates. Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.
18	61622.XP_010368297.1	0.835	DDB1 and CUL4 associated factor 10
19	61622.XP_010368171.1	0.820	WD repeat-containing protein 73 isoform X1
20	61622.XP_010381265.1	0.820	WD repeat-containing protein 59 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.932	DNA binding
GO:0140110	0.882	transcription regulator activity
GO:0043565	0.877	sequence-specific DNA binding
GO:1990837	0.810	sequence-specific double-stranded DNA binding
GO:0000976	0.797	transcription cis-regulatory region binding
GO:0008134	0.780	transcription factor binding
GO:0019899	0.665	enzyme binding
GO:0003712	0.581	transcription coregulator activity
GO:0140297	0.403	DNA-binding transcription factor binding
GO:0061629	0.393	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0050789	0.971	regulation of biological process
GO:0044238	0.969	primary metabolic process
GO:0071840	0.962	cellular component organization or biogenesis
GO:0043170	0.948	macromolecule metabolic process
GO:0016043	0.948	cellular component organization
GO:0060255	0.937	regulation of macromolecule metabolic process
GO:0080090	0.932	regulation of primary metabolic process
GO:0051171	0.932	regulation of nitrogen compound metabolic process
GO:0010468	0.931	regulation of gene expression
GO:0009889	0.927	regulation of biosynthetic process
GO:0050794	0.924	regulation of cellular process
GO:0006325	0.910	chromatin organization
GO:0016570	0.903	histone modification
GO:0031323	0.890	regulation of cellular metabolic process
GO:0048519	0.881	negative regulation of biological process
GO:0019219	0.872	regulation of nucleobase-containing compound metabolic process
GO:0009892	0.861	negative regulation of metabolic process
GO:0048523	0.858	negative regulation of cellular process
GO:0006355	0.857	regulation of DNA-templated transcription
GO:0051253	0.847	negative regulation of RNA metabolic process
GO:0009890	0.846	negative regulation of biosynthetic process
GO:1903507	0.819	negative regulation of nucleic acid-templated transcription
GO:0098732	0.801	macromolecule deacylation
GO:0045892	0.773	negative regulation of DNA-templated transcription
GO:0006476	0.761	protein deacetylation
GO:0006996	0.728	organelle organization
GO:0044237	0.600	cellular metabolic process
GO:0051276	0.550	chromosome organization
GO:0048518	0.500	positive regulation of biological process
GO:0048522	0.476	positive regulation of cellular process
GO:0006338	0.465	chromatin remodeling
GO:0032502	0.426	developmental process
GO:0044260	0.410	cellular macromolecule metabolic process
GO:0006357	0.402	regulation of transcription by RNA polymerase II
GO:0048856	0.382	anatomical structure development
GO:0032501	0.368	multicellular organismal process
GO:0050896	0.335	response to stimulus
GO:0016575	0.318	histone deacetylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.967	intracellular non-membrane-bounded organelle
GO:0032991	0.964	protein-containing complex
GO:0005694	0.879	chromosome
GO:0000785	0.847	chromatin
GO:1902494	0.764	catalytic complex
GO:0005667	0.758	transcription regulator complex
GO:0000118	0.750	histone deacetylase complex
GO:1904949	0.644	ATPase complex
GO:0070603	0.601	SWI/SNF superfamily-type complex
GO:0016581	0.501	NuRD complex
GO:0005737	0.341	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]