StarFunc result for job id Q9BTD8

User Input

>input (480 residues)
MAGAGPAPGLPGAGGPVVPGPGAGIPGKSGEERLKEMEAEMALFEQEVLGAPVPGIPTAV
PAVPTVPTVPTVEAMQVPAAPVIRPIIATNTYQQVQQTLEARAAAAATVVPPMVGGPPFV
GPVGFGPGDRSHLDSPEAREAMFLRRAAVAPQRAPILRPAFVPHVLQRADSALSSAAAGP
RPMALRPPHQALVGPPLPGPPGPPMMLPPMARAPGPPLGSMAALRPPLEEPAAPRELGLG
LGLGLKEKEEAVVAAAAGLEEASAAVAVGAGGAPAGPAVIGPSLPLALAMPLPEPEPLPL
PLEVVRGLLPPLRIPELLSLRPRPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCI
RTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGK
TKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BTD8	1.000	1.000	5.380E-74	480	1.000	1.000	Q9BTD8.pdb.gz	RBM42_HUMAN RNA-binding protein 42 OS=Homo sapiens OX=9606 GN=RBM42 PE=1 SV=1
2	PDB:6qw6R	0.205	0.853	2.133E-15	106	0.219	0.991	6qw6R.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
3	AFDB:Q7YU08	0.156	0.087	7.253E-10	865	0.179	0.099	Q7YU08.pdb.gz	Q7YU08_DROME LD15974p OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=2 SV=1
4	AFDB:Q1PEP5	0.161	0.125	5.467E-8	636	0.144	0.108	Q1PEP5.pdb.gz	NUCL2_ARATH Nucleolin 2 OS=Arabidopsis thaliana OX=3702 GN=NUCL2 PE=1 SV=1
5	AFDB:A0A0G2K850	0.172	0.128	2.514E-7	651	0.179	0.132	A0A0G2K850.pdb.gz	A0A0G2K850_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=1 SV=2
6	AFDB:A0A140UHY3	0.160	0.118	6.523E-7	661	0.177	0.129	A0A140UHY3.pdb.gz	A0A140UHY3_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=3 SV=1
7	PDB:7dvqY	0.159	0.522	7.233E-7	140	0.050	0.171	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
8	PDB:5gm6V	0.163	0.580	1.059E-6	128	0.040	0.148	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
9	PDB:5yzg1	0.151	0.295	1.456E-6	243	0.046	0.091	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
10	PDB:7ohxo	0.160	0.626	1.761E-6	112	0.048	0.205	7ohxo.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
11	PDB:5xjcw	0.158	0.788	2.131E-6	91	0.035	0.187	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
12	PDB:7oqcF	0.162	0.288	2.131E-6	267	0.060	0.109	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
13	PDB:6r5kH	0.159	0.192	3.121E-6	394	0.060	0.074	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
14	PDB:6gd1A	0.168	0.413	3.544E-6	190	0.054	0.137	6gd1A.pdb.gz
15	PDB:6g90B	0.158	0.383	4.870E-6	193	0.050	0.124	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
16	AFDB:Q9P789	0.144	0.067	2.152E-5	1065	0.165	0.074	Q9P789.pdb.gz	YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.14 PE=1 SV=2
17	AFDB:Q3UHK8	0.142	0.039	4.917E-5	1896	0.146	0.037	Q3UHK8.pdb.gz	TNR6A_MOUSE Trinucleotide repeat-containing gene 6A protein OS=Mus musculus OX=10090 GN=Tnrc6a PE=1 SV=2
18	AFDB:Q8NDV7	0.143	0.039	5.949E-5	1962	0.150	0.037	Q8NDV7.pdb.gz	TNR6A_HUMAN Trinucleotide repeat-containing gene 6A protein OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=2
19	AFDB:A0A0R4IJ26	0.143	0.043	6.340E-5	1760	0.146	0.040	A0A0R4IJ26.pdb.gz
20	AFDB:D3ZRA6	0.146	0.044	2.375E-3	1683	0.142	0.040	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q91V81	0.0	884	478	0.971	0.975	RBM42_MOUSE RNA-binding protein 42 OS=Mus musculus OX=10090 GN=Rbm42 PE=1 SV=2
2	Q9BTD8	0.0	917	480	1.000	1.000	RBM42_HUMAN RNA-binding protein 42 OS=Homo sapiens OX=9606 GN=RBM42 PE=1 SV=1
3	Q6DRG1	1.01e-77	250	402	0.263	0.313	RBM42_DANRE RNA-binding protein 42 OS=Danio rerio OX=7955 GN=rbm42 PE=2 SV=2
4	Q9VND7	1.06e-58	197	302	0.177	0.281	Q9VND7_DROME RNA-binding protein 42 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2931 PE=1 SV=1
5	Q10355	3.36e-37	138	219	0.121	0.265	YDB2_SCHPO Uncharacterized RNA-binding protein C22E12.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22E12.02 PE=4 SV=1
6	Q2UNI5	1.07e-18	90.9	477	0.079	0.080	Q2UNI5_ASPOR RRM domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090001000353 PE=4 SV=1
7	Q6YZW2	2.67e-17	86.3	447	0.079	0.085	RB208_ORYSJ RNA-binding protein 208 OS=Oryza sativa subsp. japonica OX=39947 GN=RBP-208 PE=1 SV=1
8	Q9LEB3	1.26e-16	84.0	428	0.083	0.093	RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia OX=4092 GN=RBP47 PE=1 SV=1
9	Q9LJH8	1.08e-15	81.3	427	0.073	0.082	UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana OX=3702 GN=UBP1C PE=1 SV=1
10	Q93W34	2.32e-15	80.1	415	0.075	0.087	RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana OX=3702 GN=RBP45C PE=2 SV=1
11	Q9SAB3	2.51e-15	80.1	405	0.081	0.096	RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana OX=3702 GN=RBP45B PE=1 SV=1
12	Q9SYG4	2.62e-15	80.1	426	0.075	0.085	UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana OX=3702 GN=UBP1A PE=1 SV=1
13	Q9FPJ8	4.46e-15	79.0	387	0.075	0.093	RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana OX=3702 GN=RBP45A PE=2 SV=1
14	Q0J9Y2	4.60e-15	79.3	425	0.079	0.089	RBPL_ORYSJ RNA-binding protein L OS=Oryza sativa subsp. japonica OX=39947 GN=RBP-L PE=1 SV=1
15	Q9LQI9	8.02e-15	78.6	419	0.077	0.088	UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana OX=3702 GN=UBP1B PE=1 SV=1
16	Q9LEB4	1.39e-14	77.8	409	0.077	0.090	RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia OX=4092 GN=RBP45 PE=1 SV=1
17	P32588	1.67e-14	77.8	453	0.075	0.079	PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUB1 PE=1 SV=4
18	Q5ARJ0	1.76e-14	77.4	393	0.077	0.094	Q5ARJ0_EMENI RRM domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09090 PE=4 SV=1
19	Q93194	1.96e-14	76.3	312	0.067	0.103	Q93194_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rnp-9 PE=4 SV=4
20	F4HV67	4.27e-14	76.3	430	0.075	0.084	F4HV67_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana OX=3702 GN=UBP1A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	4.7e-14	63.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262633

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365439	0.952	Heterogeneous nuclear ribonucleoprotein K
2	9606.ENSP00000310448	0.939	U4/U6.U5 tri-snRNP-associated protein 1
3	9606.ENSP00000243563	0.934	U1 small nuclear ribonucleoprotein A
4	9606.ENSP00000266079	0.915	Pre-mRNA-processing factor 6
5	9606.ENSP00000318861	0.885	Splicing factor 3B subunit 2
6	9606.ENSP00000324122	0.885	U4/U6 small nuclear ribonucleoprotein Prp31
7	9606.ENSP00000337194	0.882	Serine/threonine-protein kinase PRP4 homolog
8	9606.ENSP00000310723	0.878	Probable ATP-dependent RNA helicase DDX23
9	9606.ENSP00000315379	0.871	U4/U6 small nuclear ribonucleoprotein Prp3
10	9606.ENSP00000263694	0.861	U5 small nuclear ribonucleoprotein 40 kDa protein
11	9606.ENSP00000392094	0.860	116 kDa U5 small nuclear ribonucleoprotein component
12	9606.ENSP00000312981	0.858	U4/U6.U5 tri-snRNP-associated protein 2
13	9606.ENSP00000317123	0.856	U5 small nuclear ribonucleoprotein 200 kDa helicase
14	9606.ENSP00000400591	0.842	Small nuclear ribonucleoprotein E
15	9606.ENSP00000362110	0.838	Splicing factor 3A subunit 3
16	9606.ENSP00000412566	0.835	Small nuclear ribonucleoprotein-associated proteins B and B
17	9606.ENSP00000472998	0.835	U1 small nuclear ribonucleoprotein 70 kDa
18	9606.ENSP00000221494	0.833	Splicing factor 3A subunit 2
19	9606.ENSP00000460348	0.830	Pre-mRNA-processing-splicing factor 8
20	9606.ENSP00000335321	0.828	Splicing factor 3B subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.499	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010468	0.979	regulation of gene expression
GO:1903311	0.969	regulation of mRNA metabolic process
GO:0048519	0.964	negative regulation of biological process
GO:0043484	0.961	regulation of RNA splicing
GO:0048523	0.928	negative regulation of cellular process
GO:0050684	0.859	regulation of mRNA processing
GO:0048024	0.846	regulation of mRNA splicing, via spliceosome
GO:0009892	0.770	negative regulation of metabolic process
GO:0009987	0.719	cellular process
GO:0008152	0.705	metabolic process
GO:0071704	0.690	organic substance metabolic process
GO:0044238	0.645	primary metabolic process
GO:0010605	0.642	negative regulation of macromolecule metabolic process
GO:0043170	0.612	macromolecule metabolic process
GO:0051172	0.611	negative regulation of nitrogen compound metabolic process
GO:0031324	0.603	negative regulation of cellular metabolic process
GO:0044237	0.547	cellular metabolic process
GO:0006807	0.514	nitrogen compound metabolic process
GO:0034641	0.488	cellular nitrogen compound metabolic process
GO:0010629	0.464	negative regulation of gene expression
GO:0016070	0.447	RNA metabolic process
GO:0010467	0.432	gene expression
GO:0045934	0.395	negative regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:1990904	0.997	ribonucleoprotein complex
GO:0140513	0.996	nuclear protein-containing complex
GO:0046540	0.980	U4/U6 x U5 tri-snRNP complex
GO:0005681	0.800	spliceosomal complex
GO:0005737	0.620	cytoplasm
GO:0005829	0.408	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]