StarFunc result for job id Q9BTE0

User Input

>input (207 residues)
MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQE
DADKCTFIVLDAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGL
GTEAVLAMLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVS
ESEHQWLLEQTSHVEEKPYRDGSAEPC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BTE0	1.000	1.000	1.125E-45	207	1.000	1.000	Q9BTE0.pdb.gz	NAT9_HUMAN Alpha/beta-tubulin-N-acetyltransferase 9 OS=Homo sapiens OX=9606 GN=NAT9 PE=1 SV=1
2	AFDB:Q8S8E7	0.911	0.867	6.455E-27	218	0.459	0.436	Q8S8E7.pdb.gz	GNAT9_ARATH GCN5-related N-acetyltransferase 9 OS=Arabidopsis thaliana OX=3702 GN=GNAT9 PE=1 SV=1
3	AFDB:Q9V9V9	0.908	0.939	5.527E-26	200	0.459	0.475	Q9V9V9.pdb.gz	NAT9_DROME Alpha/beta-tubulin-N-acetyltransferase 9 OS=Drosophila melanogaster OX=7227 GN=Mnat9 PE=1 SV=1
4	AFDB:Q9USR6	0.761	0.731	2.392E-21	216	0.411	0.394	Q9USR6.pdb.gz	NAT9_SCHPO N-acetyltransferase 9-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC577.03c PE=3 SV=1
5	AFDB:P0A951	0.672	0.744	9.361E-12	186	0.174	0.194	P0A951.pdb.gz	ATDA_ECOLI Spermidine N(1)-acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=speG PE=1 SV=2
6	AFDB:Q9KL03	0.668	0.787	4.081E-11	173	0.135	0.162	Q9KL03.pdb.gz	ATDA_VIBCH Spermidine N(1)-acetyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=speG PE=1 SV=1
7	AFDB:Q5SHD1	0.638	0.675	8.522E-11	194	0.155	0.165	Q5SHD1.pdb.gz	Q5SHD1_THET8 N-acetyltransferase domain-containing protein OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA1799 PE=1 SV=1
8	PDB:6e1xC	0.680	0.791	1.803E-10	176	0.145	0.170	6e1xC.pdb.gz	Crystal structure of product-bound complex of spermidine/spermine N-acetyltransferase SpeG from Vibrio cholerae.
9	PDB:2z0zA	0.618	0.654	5.786E-10	194	0.145	0.155	2z0zA.pdb.gz
10	AFDB:O05841	0.648	0.298	1.054E-9	474	0.184	0.080	O05841.pdb.gz	O05841_MYCTU Bifunctional AAC/APH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3225c PE=1 SV=2
11	PDB:2vzzA	0.597	0.590	1.136E-9	210	0.159	0.157	2vzzA.pdb.gz	Rv0802C from Mycobacterium Tuberculosis: The First Structure of a Succinyltransferase with the Gnat Fold.
12	AFDB:Q93P57	0.608	0.307	1.268E-9	437	0.135	0.064	Q93P57.pdb.gz	Q93P57_MYXXA ActC OS=Myxococcus xanthus OX=34 GN=actC PE=4 SV=1
13	AFDB:P0A948	0.641	0.679	1.948E-9	194	0.164	0.175	P0A948.pdb.gz	RIMJ_ECOLI [Ribosomal protein uS5]-alanine N-acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rimJ PE=1 SV=1
14	PDB:3owcA	0.643	0.760	3.032E-9	172	0.164	0.198	3owcA.pdb.gz	Crystal structure of GNAT superfamily protein PA2578 from Pseudomonas aeruginosa
15	PDB:7kyjB	0.656	0.696	4.121E-9	194	0.164	0.175	7kyjB.pdb.gz	Structure of a GNAT superfamily PA3944 acetyltransferase in complex with zinc
16	PDB:4r9mA	0.597	0.716	4.659E-9	169	0.155	0.189	4r9mA.pdb.gz	Analysis of crystalline and solution states of ligand-free spermidine N-acetyltransferase (SpeG) from Escherichia coli.
17	PDB:2vzyC	0.597	0.648	6.332E-9	189	0.150	0.164	2vzyC.pdb.gz	Rv0802C from Mycobacterium Tuberculosis: The First Structure of a Succinyltransferase with the Gnat Fold.
18	PDB:4avaA	0.498	0.330	3.319E-8	327	0.159	0.101	4avaA.pdb.gz	Cyclic AMP Regulation of Protein Lysine Acetylation in Mycobacterium Tuberculosis.
19	PDB:3dr8A	0.595	0.698	8.330E-8	173	0.121	0.145	3dr8A.pdb.gz	Structure of yncA, a putative ACETYLTRANSFERASE from Salmonella typhimurium with its cofactor Acetyl-CoA
20	PDB:1yk3F	0.630	0.644	1.850E-7	202	0.101	0.104	1yk3F.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BTE0	1.31e-154	428	207	1.000	1.000	NAT9_HUMAN Alpha/beta-tubulin-N-acetyltransferase 9 OS=Homo sapiens OX=9606 GN=NAT9 PE=1 SV=1
2	Q8S8E7	3.07e-59	187	218	0.440	0.417	GNAT9_ARATH GCN5-related N-acetyltransferase 9 OS=Arabidopsis thaliana OX=3702 GN=GNAT9 PE=1 SV=1
3	Q9V9V9	3.09e-49	160	200	0.459	0.475	NAT9_DROME Alpha/beta-tubulin-N-acetyltransferase 9 OS=Drosophila melanogaster OX=7227 GN=Mnat9 PE=1 SV=1
4	Q9USR6	1.04e-44	150	216	0.440	0.421	NAT9_SCHPO N-acetyltransferase 9-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC577.03c PE=3 SV=1
5	P0A951	1.16e-04	43.5	186	0.101	0.113	ATDA_ECOLI Spermidine N(1)-acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=speG PE=1 SV=2
6	P20092	0.29	33.5	201	0.097	0.100	AAC6_SERMA Aminoglycoside N(6')-acetyltransferase type 1 OS=Serratia marcescens OX=615 GN=aacA4 PE=1 SV=1
7	P19650	0.30	33.5	201	0.097	0.100	AAC6_KLEPN Aminoglycoside N(6')-acetyltransferase type 1 OS=Klebsiella pneumoniae OX=573 GN=aacA4 PE=3 SV=1
8	Q9KL03	2.8	30.4	173	0.097	0.116	ATDA_VIBCH Spermidine N(1)-acetyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=speG PE=1 SV=1
9	Q9I0Q8	6.1	29.6	186	0.174	0.194	ATSE2_PSEAE Acetyltransferase PA2578 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA2578 PE=1 SV=1
10	Q5VY80	7.0	29.6	246	0.106	0.089	ULBP6_HUMAN UL16-binding protein 6 OS=Homo sapiens OX=9606 GN=RAET1L PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00583 Acetyltransf_1	0.00018	33.1	Acetyltransferase (GNAT) family
2	PF13302 Acetyltransf_3	4.4e-23	93.9	Acetyltransferase (GNAT) domain
3	PF13508 Acetyltransf_7	1.8e+02	13.9	Acetyltransferase (GNAT) domain
4	PF13523 Acetyltransf_8	0.27	22.4	Acetyltransferase (GNAT) domain
5	PF08445 FR47	0.00015	33.0	FR47-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350467

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342499	0.813	Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2
2	9606.ENSP00000205194	0.760	N-acetyltransferase 14
3	9606.ENSP00000335636	0.758	N-alpha-acetyltransferase 20
4	9606.ENSP00000405482	0.717	Putative transporter SVOPL
5	9606.ENSP00000458715	0.715	Caspase recruitment domain-containing protein 14
6	9606.ENSP00000413064	0.703	N-acetylaspartate synthetase
7	9606.ENSP00000257181	0.700	Pre-mRNA-splicing factor 38A
8	9606.ENSP00000313377	0.695	Pantothenate kinase 2, mitochondrial
9	9606.ENSP00000350718	0.684	Transmembrane and coiled-coil domains protein 2
10	9606.ENSP00000257829	0.676	RNA cytidine acetyltransferase
11	9606.ENSP00000263245	0.673	ADP-ribosylation factor GTPase-activating protein 3
12	9606.ENSP00000307272	0.642	Regulatory-associated protein of mTOR
13	9606.ENSP00000376397	0.642	CMRF35-like molecule 7
14	9606.ENSP00000414287	0.642	Hepatocyte growth factor-like protein
15	9606.ENSP00000353259	0.641	CMRF35-like molecule 8
16	9606.ENSP00000396755	0.632	Cyclin N-terminal domain containing 2
17	9606.ENSP00000262613	0.614	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
18	9606.ENSP00000369038	0.613	Eukaryotic translation elongation factor 1 epsilon-1
19	9606.ENSP00000256951	0.607	Epithelial membrane protein 1
20	9606.ENSP00000307260	0.559	Transducin beta-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016410	0.963	N-acyltransferase activity
GO:0016407	0.962	acetyltransferase activity
GO:0008080	0.953	N-acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0048519	0.976	negative regulation of biological process
GO:0048518	0.815	positive regulation of biological process
GO:0048523	0.802	negative regulation of cellular process
GO:0048522	0.788	positive regulation of cellular process
GO:0009987	0.733	cellular process
GO:0008152	0.647	metabolic process
GO:0071704	0.540	organic substance metabolic process
GO:0051128	0.532	regulation of cellular component organization
GO:0006807	0.469	nitrogen compound metabolic process
GO:0044238	0.460	primary metabolic process
GO:0048583	0.427	regulation of response to stimulus
GO:0023051	0.410	regulation of signaling
GO:0010646	0.410	regulation of cell communication
GO:0033043	0.401	regulation of organelle organization
GO:1902531	0.396	regulation of intracellular signal transduction
GO:0019222	0.388	regulation of metabolic process
GO:0044237	0.355	cellular metabolic process
GO:0048585	0.340	negative regulation of response to stimulus
GO:0080134	0.339	regulation of response to stress
GO:0009968	0.326	negative regulation of signal transduction
GO:0051129	0.318	negative regulation of cellular component organization
GO:0044087	0.313	regulation of cellular component biogenesis
GO:0043170	0.305	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.996	protein-containing complex
GO:0110165	0.939	cellular anatomical entity
GO:0005622	0.923	intracellular anatomical structure
GO:0043231	0.914	intracellular membrane-bounded organelle
GO:0005737	0.889	cytoplasm
GO:0005634	0.808	nucleus
GO:0070013	0.779	intracellular organelle lumen
GO:0005829	0.741	cytosol
GO:0031981	0.621	nuclear lumen
GO:0016020	0.461	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	0.963	Transferring groups other than amino-acyl groups.

[back to server]