StarFunc result for job id Q9BTE1

User Input

>input (182 residues)
MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRH
CVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRC
VLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLT
QV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BTE1	1.000	1.000	2.949E-35	182	1.000	1.000	Q9BTE1.pdb.gz	DCTN5_HUMAN Dynactin subunit 5 OS=Homo sapiens OX=9606 GN=DCTN5 PE=1 SV=1
2	AFDB:Q54XU5	0.980	0.902	1.896E-23	198	0.516	0.475	Q54XU5.pdb.gz	DCTN5_DICDI Dynactin subunit 5 OS=Dictyostelium discoideum OX=44689 GN=dynE PE=3 SV=1
3	AFDB:Q9NHE4	0.956	0.922	1.868E-22	189	0.599	0.577	Q9NHE4.pdb.gz	Q9NHE4_DROME Dynactin subunit 5 OS=Drosophila melanogaster OX=7227 GN=DCTN5-p25 PE=2 SV=1
4	AFDB:Q9N4I1	0.975	0.965	1.694E-19	184	0.429	0.424	Q9N4I1.pdb.gz	Q9N4I1_CAEEL Dynactin subunit 5 OS=Caenorhabditis elegans OX=6239 GN=dnc-5 PE=1 SV=2
5	PDB:5nw4h	0.814	0.893	3.347E-19	165	0.890	0.982	5nw4h.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
6	AFDB:Q5B358	0.854	0.773	1.743E-14	202	0.346	0.312	Q5B358.pdb.gz	Q5B358_EMENI Dynactin subunit 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05022 PE=3 SV=1
7	AFDB:Q9SMN1	0.625	0.459	2.361E-10	256	0.203	0.145	Q9SMN1.pdb.gz	GCAL2_ARATH Gamma carbonic anhydrase-like 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACAL2 PE=1 SV=1
8	AFDB:Q94AU7	0.646	0.464	4.406E-10	258	0.170	0.120	Q94AU7.pdb.gz	GCA3_ARATH Gamma carbonic anhydrase 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACA3 PE=1 SV=1
9	AFDB:F4KAQ8	0.632	0.425	9.609E-10	279	0.198	0.129	F4KAQ8.pdb.gz	F4KAQ8_ARATH Gamma carbonic anhydrase like 1 OS=Arabidopsis thaliana OX=3702 GN=GAMMA PE=1 SV=1
10	PDB:7aqqz	0.634	0.503	2.731E-9	233	0.159	0.124	7aqqz.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
11	AFDB:Q9FWR5	0.671	0.454	7.688E-9	275	0.165	0.109	Q9FWR5.pdb.gz	GCA1_ARATH Gamma carbonic anhydrase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACA1 PE=1 SV=1
12	PDB:7aqqx	0.539	0.464	1.519E-8	214	0.198	0.168	7aqqx.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
13	AFDB:Q9C6B3	0.655	0.438	1.766E-8	278	0.154	0.101	Q9C6B3.pdb.gz	GCA2_ARATH Gamma carbonic anhydrase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACA2 PE=1 SV=1
14	PDB:3tioF	0.754	0.775	4.525E-8	177	0.165	0.169	3tioF.pdb.gz	Structures of the gamma-class carbonic anhydrase homologue YrdA suggest a possible allosteric switch
15	PDB:7aqqy	0.677	0.469	4.017E-7	268	0.159	0.108	7aqqy.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
16	PDB:1thjA	0.445	0.387	3.756E-6	213	0.154	0.131	1thjA.pdb.gz	A left-hand beta-helix revealed by the crystal structure of a carbonic anhydrase from the archaeon Methanosarcina thermophila.
17	PDB:2jf2A	0.356	0.259	9.090E-6	264	0.159	0.110	2jf2A.pdb.gz
18	PDB:1ocxA	0.494	0.494	5.054E-5	182	0.148	0.148	1ocxA.pdb.gz
19	PDB:3tv0A	0.486	0.603	6.222E-5	143	0.137	0.175	3tv0A.pdb.gz
20	PDB:7ojpZ	0.322	0.246	8.069E-5	261	0.181	0.126	7ojpZ.pdb.gz	Discovery of Novel UDP- N -Acetylglucosamine Acyltransferase (LpxA) Inhibitors with Activity against Pseudomonas aeruginosa .

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BTE1	1.48e-133	372	182	1.000	1.000	DCTN5_HUMAN Dynactin subunit 5 OS=Homo sapiens OX=9606 GN=DCTN5 PE=1 SV=1
2	Q9QZB9	2.34e-133	372	182	0.995	0.995	DCTN5_MOUSE Dynactin subunit 5 OS=Mus musculus OX=10090 GN=Dctn5 PE=1 SV=1
3	Q9NHE4	1.56e-77	231	189	0.588	0.566	Q9NHE4_DROME Dynactin subunit 5 OS=Drosophila melanogaster OX=7227 GN=DCTN5-p25 PE=2 SV=1
4	Q9VJQ6	4.26e-77	230	189	0.588	0.566	Q9VJQ6_DROME Dynactin subunit 5 OS=Drosophila melanogaster OX=7227 GN=DCTN5-p25 PE=1 SV=1
5	Q54XU5	1.04e-68	209	198	0.516	0.475	DCTN5_DICDI Dynactin subunit 5 OS=Dictyostelium discoideum OX=44689 GN=dynE PE=3 SV=1
6	Q9N4I1	2.80e-55	174	184	0.434	0.429	Q9N4I1_CAEEL Dynactin subunit 5 OS=Caenorhabditis elegans OX=6239 GN=dnc-5 PE=1 SV=2
7	Q5B358	8.45e-34	120	202	0.363	0.327	Q5B358_EMENI Dynactin subunit 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05022 PE=3 SV=1
8	Q9SMN1	8.40e-05	43.9	256	0.225	0.160	GCAL2_ARATH Gamma carbonic anhydrase-like 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACAL2 PE=1 SV=1
9	Q9C6B3	1.07e-04	43.9	278	0.159	0.104	GCA2_ARATH Gamma carbonic anhydrase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACA2 PE=1 SV=1
10	Q9FMV1	3.12e-04	42.4	252	0.220	0.159	GCAL1_ARATH Gamma carbonic anhydrase-like 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACAL1 PE=1 SV=1
11	Q9FWR5	0.008	38.1	275	0.159	0.105	GCA1_ARATH Gamma carbonic anhydrase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACA1 PE=1 SV=1
12	Q94AU7	0.009	38.1	258	0.137	0.097	GCA3_ARATH Gamma carbonic anhydrase 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GAMMACA3 PE=1 SV=1
13	F4KAQ8	0.021	37.0	279	0.242	0.158	F4KAQ8_ARATH Gamma carbonic anhydrase like 1 OS=Arabidopsis thaliana OX=3702 GN=GAMMA PE=1 SV=1
14	P0A9W9	0.11	34.7	184	0.148	0.147	YRDA_ECOLI Protein YrdA OS=Escherichia coli (strain K12) OX=83333 GN=yrdA PE=1 SV=1
15	Q8YHR0	0.23	33.5	175	0.132	0.137	Q8YHR0_BRUME Ferripyochelin binding protein OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) OX=224914 GN=BMEI0736 PE=4 SV=1
16	P56287	0.41	33.5	678	0.126	0.034	EI2BE_SCHPO Probable translation initiation factor eIF-2B subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif225 PE=1 SV=1
17	Q9X6P4	0.54	32.7	258	0.115	0.081	LPXA_PSEAE Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lpxA PE=3 SV=1
18	O00399	0.57	32.3	190	0.099	0.095	DCTN6_HUMAN Dynactin subunit 6 OS=Homo sapiens OX=9606 GN=DCTN6 PE=1 SV=1
19	Q4QBG5	0.61	32.7	379	0.082	0.040	Q4QBG5_LEIMA mannose-1-phosphate guanylyltransferase OS=Leishmania major OX=5664 GN=GDPMP PE=3 SV=1
20	G3XD01	1.0	31.6	191	0.099	0.094	WBPD_PSEAE UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=wbpD PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16314 DUF4954	34	14.0	Domain of unknown function (DUF4954)
2	PF07959 Fucokinase	2e+02	12.3	L-fucokinase
3	PF00132 Hexapep	4.2e-10	50.1	Bacterial transferase hexapeptide (six repeats)
4	PF14602 Hexapep_2	2.2	19.4	Hexapeptide repeat of succinyl-transferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 29073.XP_008695380.1

Rank	PPI partner	STRING score	Description
1	29073.XP_008684793.1	0.999	Dynactin subunit 6
2	29073.XP_008682251.1	0.998	Dynactin subunit 2 isoform X1
3	29073.XP_008690726.1	0.998	Dynactin subunit 4
4	29073.XP_008700343.1	0.998	Belongs to the actin family.
5	29073.XP_008708682.1	0.996	ARP1 actin-related protein 1 homolog A, centractin alpha
6	29073.XP_008698019.1	0.983	ARP1 actin-related protein 1 homolog B, centractin beta
7	29073.XP_008698235.1	0.979	Dynactin subunit 1 isoform X1
8	29073.XP_008693367.1	0.969	Dynactin subunit 3
9	29073.XP_008682429.1	0.950	Dynein cytoplasmic 1 heavy chain 1
10	29073.XP_008692174.1	0.926	Dynein intermediate chain 2, axonemal
11	29073.XP_008692885.1	0.923	F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments
12	29073.XP_008693436.1	0.901	Dynein intermediate chain 1, axonemal
13	29073.XP_008700786.1	0.897	Cytoplasmic dynein 1 light intermediate chain 2
14	29073.XP_008703771.1	0.897	Dynein light chain 4, axonemal isoform X1
15	29073.XP_008685337.1	0.894	Cytoplasmic dynein 1 intermediate chain 2
16	29073.XP_008709845.1	0.878	Cytoplasmic dynein 1 light intermediate chain 1
17	29073.XP_008684597.1	0.876	Dynein axonemal heavy chain 11
18	29073.XP_008685761.1	0.876	Dynein heavy chain 7, axonemal
19	29073.XP_008686320.1	0.876	Dynein heavy chain 2, axonemal
20	29073.XP_008686348.1	0.876	Dynein axonemal heavy chain 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.407	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.936	multicellular organismal process
GO:0035904	0.916	aorta development
GO:0003205	0.905	cardiac chamber development
GO:0003279	0.904	cardiac septum development
GO:0060976	0.904	coronary vasculature development
GO:0003231	0.902	cardiac ventricle development
GO:0009987	0.860	cellular process
GO:0003281	0.805	ventricular septum development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005856	0.999	cytoskeleton
GO:0016020	0.997	membrane
GO:0015630	0.994	microtubule cytoskeleton
GO:0012505	0.993	endomembrane system
GO:0005654	0.991	nucleoplasm
GO:0005829	0.970	cytosol
GO:0031090	0.951	organelle membrane
GO:0032991	0.947	protein-containing complex
GO:0005815	0.896	microtubule organizing center
GO:0031967	0.866	organelle envelope
GO:0005813	0.860	centrosome
GO:0005635	0.714	nuclear envelope
GO:0031965	0.685	nuclear membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]