StarFunc result for job id Q9BTE6

User Input

>input (412 residues)
MAFWCQRDSYAREFTTTVVSCCPAELQTEGSNGKKEVLSGFQVVLEDTVLFPEGGGQPDD
RGTINDISVLRVTRRGEQADHFTQTPLDPGSQVLVRVDWERRFDHMQQHSGQHLITAVAD
HLFKLKTTSWELGRFRSAIELDTPSMTAEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEV
EQVSGRGLPDDHAGPIRVVNIEGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNRTNLIF
LSGNRVLKWMERSHGTEKALTALLKCGAEDHVEAVKKLQNSTKILQKNNLNLLRDLAVHI
AHSLRNSPDWGGVVILHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGGGLFLLAGPPA
SVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRMEAQALLQDYISTQSAKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3THG9	0.994	0.994	5.165E-78	412	0.900	0.900	Q3THG9.pdb.gz	AASD1_MOUSE Alanyl-tRNA editing protein Aarsd1 OS=Mus musculus OX=10090 GN=Aarsd1 PE=1 SV=2
2	AFDB:Q38ES2	0.847	0.751	1.457E-39	468	0.347	0.306	Q38ES2.pdb.gz	Q38ES2_TRYB2 Alanyl-transfer RNA synthetases family profile domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4850 PE=3 SV=1
3	AFDB:P53960	0.779	0.711	2.576E-34	456	0.318	0.287	P53960.pdb.gz	YNE0_YEAST Putative alanyl-tRNA editing protein alaX OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNL040W PE=1 SV=1
4	AFDB:Q9FFC7	0.801	0.358	4.065E-30	978	0.221	0.093	Q9FFC7.pdb.gz	SYAP_ARATH Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB86 PE=1 SV=2
5	AFDB:A7ZQC5	0.781	0.391	3.277E-29	876	0.197	0.092	A7ZQC5.pdb.gz	SYA_ECO24 Alanine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) OX=331111 GN=alaS PE=3 SV=1
6	AFDB:O58035	0.772	0.370	5.372E-29	915	0.218	0.098	O58035.pdb.gz	SYA_PYRHO Alanine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=alaS PE=1 SV=1
7	AFDB:P9WFW7	0.798	0.387	6.020E-28	904	0.209	0.095	P9WFW7.pdb.gz	SYA_MYCTU Alanine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=alaS PE=1 SV=1
8	AFDB:Q57984	0.743	0.367	9.911E-27	892	0.204	0.094	Q57984.pdb.gz	SYA_METJA Alanine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=alaS PE=1 SV=1
9	AFDB:O28029	0.745	0.362	1.047E-26	906	0.187	0.085	O28029.pdb.gz	SYA_ARCFU Alanine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=alaS PE=1 SV=1
10	AFDB:Q5A8K2	0.627	0.302	1.384E-25	969	0.184	0.078	Q5A8K2.pdb.gz	SYA_CANAL Alanine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALA1 PE=1 SV=1
11	PDB:3wqyA	0.715	0.356	3.316E-24	905	0.197	0.090	3wqyA.pdb.gz	The selective tRNA aminoacylation mechanism based on a single G.U pair
12	PDB:2e1bA	0.438	0.814	2.627E-14	216	0.121	0.231	2e1bA.pdb.gz
13	PDB:3rfnA	0.308	0.780	2.549E-8	151	0.078	0.212	3rfnA.pdb.gz	Computational design of high-affinity epitope scaffolds by backbone grafting of a linear epitope.
14	PDB:1v4pC	0.308	0.770	9.016E-8	155	0.073	0.194	1v4pC.pdb.gz	Crystal structure of alanyl-tRNA synthetase editing-domain homolog (PH0574) from a hyperthermophile, Pyrococcus horikoshii OT3 at 1.45 A resolution
15	PDB:1qf6A	0.320	0.215	1.072E-5	641	0.131	0.084	1qf6A.pdb.gz	The structure of threonyl-tRNA synthetase-tRNA(Thr) complex enlightens its repressor activity and reveals an essential zinc ion in the active site
16	PDB:5f55A	0.230	0.142	2.089E-3	705	0.056	0.033	5f55A.pdb.gz	Structural basis for DNA 5 -end resection by RecJ
17	PDB:3j7y7	0.274	0.402	2.750E-3	266	0.070	0.109	3j7y7.pdb.gz	Structure of the large ribosomal subunit from human mitochondria.
18	PDB:2qb6A	0.155	0.161	4.039E-3	393	0.046	0.048	2qb6A.pdb.gz	The crystal structure of the cytosolic exopolyphosphatase from Saccharomyces cerevisiae reveals the basis for substrate specificity.
19	PDB:5dgoA	0.206	0.164	4.762E-3	541	0.051	0.039	5dgoA.pdb.gz
20	PDB:5lzwii	0.090	0.096	5.932E-3	372	0.056	0.062	5lzwii.pdb.gz	Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3THG9	0.0	745	412	0.900	0.900	AASD1_MOUSE Alanyl-tRNA editing protein Aarsd1 OS=Mus musculus OX=10090 GN=Aarsd1 PE=1 SV=2
2	Q9BTE6	0.0	848	412	1.000	1.000	AASD1_HUMAN Alanyl-tRNA editing protein Aarsd1 OS=Homo sapiens OX=9606 GN=AARSD1 PE=1 SV=2
3	Q38ES2	1.30e-58	200	468	0.364	0.321	Q38ES2_TRYB2 Alanyl-transfer RNA synthetases family profile domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4850 PE=3 SV=1
4	P53960	2.58e-42	156	456	0.299	0.270	YNE0_YEAST Putative alanyl-tRNA editing protein alaX OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNL040W PE=1 SV=1
5	Q46AR9	1.37e-22	97.8	243	0.175	0.296	ALAXM_METBF Alanyl-tRNA editing protein AlaX-M OS=Methanosarcina barkeri (strain Fusaro / DSM 804) OX=269797 GN=alaXM PE=1 SV=1
6	Q8Q0A4	6.99e-20	90.5	251	0.172	0.283	ALAXM_METMA Alanyl-tRNA editing protein AlaX-M OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) OX=192952 GN=alaXM PE=1 SV=2
7	O58035	2.63e-17	86.7	915	0.184	0.083	SYA_PYRHO Alanine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=alaS PE=1 SV=1
8	Q57984	8.22e-17	85.1	892	0.226	0.104	SYA_METJA Alanine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=alaS PE=1 SV=1
9	Q97ZX2	4.43e-14	73.6	236	0.150	0.263	ALAXM_SACS2 Alanyl-tRNA editing protein AlaX-M OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=alaXM PE=1 SV=1
10	O57848	2.53e-12	68.2	216	0.129	0.245	ALAXM_PYRHO Alanyl-tRNA editing protein AlaX-M OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=alaXM PE=1 SV=1
11	A7ZQC5	1.54e-08	59.3	876	0.216	0.102	SYA_ECO24 Alanine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) OX=331111 GN=alaS PE=3 SV=1
12	P00957	2.50e-08	58.5	876	0.216	0.102	SYA_ECOLI Alanine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=alaS PE=1 SV=2
13	Q9VRJ1	2.99e-08	58.2	1012	0.143	0.058	SYAM_DROME Alanine--tRNA ligase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=AlaRS-m PE=2 SV=1
14	Q9VLM8	3.01e-08	58.2	966	0.155	0.066	SYAC_DROME Alanine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=AlaRS PE=2 SV=1
15	O28029	1.03e-07	56.6	906	0.206	0.094	SYA_ARCFU Alanine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=alaS PE=1 SV=1
16	Q9FFC7	8.98e-07	53.5	978	0.155	0.065	SYAP_ARATH Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB86 PE=1 SV=2
17	Q8BGQ7	1.89e-06	52.8	968	0.155	0.066	SYAC_MOUSE Alanine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Aars1 PE=1 SV=1
18	P40825	3.61e-06	51.6	983	0.148	0.062	SYA_YEAST Alanine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALA1 PE=1 SV=3
19	P50475	5.46e-06	51.2	968	0.163	0.069	SYAC_RAT Alanine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Aars1 PE=1 SV=3
20	P9WFW7	9.87e-06	50.4	904	0.226	0.103	SYA_MYCTU Alanine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=alaS PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01411 tRNA-synt_2c	0.035	24.3	tRNA synthetases class II (A)
2	PF07973 tRNA_SAD	6.4e-06	37.5	Threonyl and Alanyl tRNA synthetase second additional domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400870

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261772	0.771	Alanine--tRNA ligase, cytoplasmic
2	9606.ENSP00000221855	0.688	Tubulin-folding cofactor B
3	9606.ENSP00000310117	0.682	Protein phosphatase 1 regulatory subunit 14B
4	9606.ENSP00000367991	0.679	Septin-8
5	9606.ENSP00000256649	0.670	Tripartite motif-containing protein 45
6	9606.ENSP00000305494	0.615	Spermatogenesis-associated protein 5-like protein 1
7	9606.ENSP00000310015	0.607	tRNA-specific adenosine deaminase 1
8	9606.ENSP00000325448	0.598	Lysine--tRNA ligase
9	9606.ENSP00000254719	0.578	Replication protein A 70 kDa DNA-binding subunit
10	9606.ENSP00000352268	0.554	Arylacetamide deacetylase-like 3
11	9606.ENSP00000354425	0.551	E3 ubiquitin-protein ligase Jade-2
12	9606.ENSP00000364382	0.516	Thioredoxin-like protein AAED1
13	9606.ENSP00000275884	0.503	DENN domain-containing protein 2A
14	9606.ENSP00000384214	0.503	G antigen 12D
15	9606.ENSP00000397103	0.503	G antigen 12C
16	9606.ENSP00000324196	0.500	Serine/threonine-protein kinase LMTK1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0002161	1.000	aminoacyl-tRNA editing activity
GO:0002196	0.688	Ser-tRNA(Ala) hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.966	biological regulation
GO:0065008	0.962	regulation of biological quality
GO:0009987	0.668	cellular process
GO:0008152	0.631	metabolic process
GO:0044238	0.623	primary metabolic process
GO:0071704	0.611	organic substance metabolic process
GO:0006807	0.611	nitrogen compound metabolic process
GO:0044237	0.502	cellular metabolic process
GO:0043170	0.485	macromolecule metabolic process
GO:0034641	0.453	cellular nitrogen compound metabolic process
GO:0006139	0.431	nucleobase-containing compound metabolic process
GO:1901564	0.430	organonitrogen compound metabolic process
GO:0090304	0.407	nucleic acid metabolic process
GO:0019538	0.395	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.938	cytoplasm
GO:0005829	0.362	cytosol
GO:0070013	0.342	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.1.-	1.000	Carboxylic ester hydrolases.

[back to server]