StarFunc result for job id Q9BTP6

User Input

>input (218 residues)
MMRREDEEEEGTMMKAKGDLEMKEEEEISETGELVGPFVSAMPTPMPHNKGTRFSEAWEY
FHLAPARAGHHPNQYATCRLCGRQVSRGPGVNVGTTALWKHLKSMHREELEKSGHGQAGQ
RQDPRPHGPQLPTGIEGNWGRLLEQVGTMALWASQREKEVLRRERAVEWRERAVEKRERA
LEEVERAILEMKWKVRAEKEACQREKELPAAVHPFHFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BTP6	1.000	1.000	1.334E-34	218	1.000	1.000	Q9BTP6.pdb.gz	ZBED2_HUMAN Zinc finger BED domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZBED2 PE=1 SV=2
2	AFDB:Q96IU2	0.347	0.326	5.337E-14	234	0.454	0.423	Q96IU2.pdb.gz	ZBED3_HUMAN Zinc finger BED domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBED3 PE=1 SV=1
3	AFDB:Q9D0L1	0.378	0.362	7.298E-9	228	0.330	0.316	Q9D0L1.pdb.gz	ZBED3_MOUSE Zinc finger BED domain-containing protein 3 OS=Mus musculus OX=10090 GN=Zbed3 PE=1 SV=1
4	AFDB:Q80WQ9	0.249	0.052	2.603E-4	1168	0.147	0.027	Q80WQ9.pdb.gz	ZBED4_MOUSE Zinc finger BED domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zbed4 PE=2 SV=1
5	AFDB:Q0JMB2	0.233	0.091	9.331E-4	684	0.128	0.041	Q0JMB2.pdb.gz	RSLE4_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 4 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0518400 PE=2 SV=3
6	AFDB:P86452	0.254	0.071	9.980E-4	979	0.128	0.029	P86452.pdb.gz	ZBED6_HUMAN Zinc finger BED domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ZBED6 PE=1 SV=1
7	AFDB:D2EAC2	0.243	0.060	1.954E-3	980	0.147	0.033	D2EAC2.pdb.gz	ZBED6_MOUSE Zinc finger BED domain-containing protein 6 OS=Mus musculus OX=10090 GN=Zbed6 PE=1 SV=1
8	AFDB:P93758	0.224	0.192	1.541E-1	274	0.174	0.139	P93758.pdb.gz	RMR42_ARATH Remorin 4.2 OS=Arabidopsis thaliana OX=3702 GN=REM4.2 PE=1 SV=1
9	AFDB:O18696	0.151	0.061	2.466E-1	664	0.179	0.059	O18696.pdb.gz	PDE1_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-1 OS=Caenorhabditis elegans OX=6239 GN=pde-1 PE=1 SV=2
10	PDB:4btsA9	0.094	0.169	2.506E-1	93	0.055	0.129	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
11	AFDB:G4SJU0	0.108	0.063	2.637E-1	432	0.119	0.060	G4SJU0.pdb.gz	G4SJU0_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T15B12.1 PE=1 SV=1
12	PDB:4v6wCp	0.101	0.194	4.907E-1	91	0.050	0.121	4v6wCp.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	PDB:5apnp	0.100	0.188	6.867E-1	91	0.050	0.121	5apnp.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
14	PDB:1m4mA	0.161	0.280	7.854E-1	112	0.055	0.107	1m4mA.pdb.gz	CRYSTAL STRUCTURE AND MUTAGENIC ANALYSIS OF THE INHIBITOR-OF-APOPTOSIS PROTEIN SURVIVIN
15	PDB:6c4iv	0.127	0.086	9.609E-1	362	0.037	0.022	6c4iv.pdb.gz	Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
16	PDB:1j8iA	0.125	0.246	1.175	93	0.083	0.194	1j8iA.pdb.gz
17	PDB:5aj0Ap	0.103	0.186	1.645	91	0.060	0.143	5aj0Ap.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
18	PDB:1yw5A	0.117	0.140	1.881	177	0.032	0.040	1yw5A.pdb.gz
19	PDB:3uedC	0.184	0.274	2.152	139	0.096	0.151	3uedC.pdb.gz	Molecular basis for phosphospecific recognition of histone H3 tails by Survivin paralogues at inner centromeres.
20	PDB:6fyxm	0.106	0.149	2.152	147	0.023	0.034	6fyxm.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BTP6	7.28e-160	442	218	1.000	1.000	ZBED2_HUMAN Zinc finger BED domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZBED2 PE=1 SV=2
2	Q96IU2	1.48e-31	117	234	0.381	0.355	ZBED3_HUMAN Zinc finger BED domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBED3 PE=1 SV=1
3	Q9D0L1	2.60e-23	95.5	228	0.298	0.285	ZBED3_MOUSE Zinc finger BED domain-containing protein 3 OS=Mus musculus OX=10090 GN=Zbed3 PE=1 SV=1
4	O75132	3.62e-04	43.5	1171	0.106	0.020	ZBED4_HUMAN Zinc finger BED domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBED4 PE=1 SV=2
5	Q94513	4.21e-04	42.7	282	0.096	0.074	Q94513_DROME Boundary element associated factor OS=Drosophila melanogaster OX=7227 GN=BEAF-32 PE=1 SV=1
6	P86452	4.53e-04	43.1	979	0.106	0.023	ZBED6_HUMAN Zinc finger BED domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ZBED6 PE=1 SV=1
7	D2EAC2	4.75e-04	43.1	980	0.106	0.023	ZBED6_MOUSE Zinc finger BED domain-containing protein 6 OS=Mus musculus OX=10090 GN=Zbed6 PE=1 SV=1
8	Q80WQ9	0.004	40.0	1168	0.101	0.019	ZBED4_MOUSE Zinc finger BED domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zbed4 PE=2 SV=1
9	G5EF80	0.28	34.7	966	0.083	0.019	G5EF80_CAEEL F-BAR domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=spv-1 PE=1 SV=1
10	Q19787	0.38	33.9	599	0.078	0.028	BED3_CAEEL Zinc finger BED domain-containing protein 3 OS=Caenorhabditis elegans OX=6239 GN=bed-3 PE=1 SV=1
11	Q6AVI0	0.50	33.9	722	0.128	0.039	RSLE2_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 2 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0733400 PE=2 SV=1
12	O13919	0.63	33.5	1075	0.165	0.033	PST2_SCHPO Paired amphipathic helix protein pst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pst2 PE=1 SV=1
13	B2RH58	1.8	32.0	670	0.087	0.028	FIMD_PORG3 Major fimbrium tip subunit FimD OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561) OX=431947 GN=fimD PE=1 SV=1
14	A1Z8Q7	2.4	31.6	779	0.083	0.023	A1Z8Q7_DROME Microcephalin, isoform A OS=Drosophila melanogaster OX=7227 GN=MCPH1 PE=1 SV=1
15	A5YTR9	2.4	31.6	981	0.083	0.018	A5YTR9_DROME IP08064p OS=Drosophila melanogaster OX=7227 GN=MCPH1 PE=1 SV=1
16	E1JH39	2.4	31.6	1028	0.083	0.018	E1JH39_DROME Microcephalin, isoform D OS=Drosophila melanogaster OX=7227 GN=MCPH1 PE=1 SV=1
17	Q7JUM5	2.4	31.6	826	0.083	0.022	Q7JUM5_DROME LD43341p OS=Drosophila melanogaster OX=7227 GN=MCPH1 PE=1 SV=1
18	O14284	7.4	29.6	188	0.060	0.069	OXR1_SCHPO Oxidation resistance protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=oxr1 PE=1 SV=1
19	E9PFQ4	8.5	30.0	1115	0.092	0.018	E9PFQ4_HUMAN Pleckstrin homology like domain family B member 2 (Fragment) OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=1
20	Q86SQ0	8.6	30.0	1253	0.092	0.016	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08209 Sgf11	1.9e+02	13.0	Sgf11 (transcriptional regulation protein)
2	PF02892 zf-BED	1e-07	43.1	BED zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321370

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000447879	0.698	Zinc finger BED domain-containing protein 6
2	9606.ENSP00000216268	0.640	Zinc finger BED-type containing 4
3	9606.ENSP00000426613	0.501	TNFAIP3-interacting protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0005515	0.877	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.990	positive regulation of biological process
GO:1902679	0.988	negative regulation of RNA biosynthetic process
GO:0045682	0.987	regulation of epidermis development
GO:0030856	0.986	regulation of epithelial cell differentiation
GO:0045597	0.984	positive regulation of cell differentiation
GO:0006355	0.976	regulation of DNA-templated transcription
GO:0000122	0.966	negative regulation of transcription by RNA polymerase II
GO:0045604	0.947	regulation of epidermal cell differentiation
GO:0030858	0.929	positive regulation of epithelial cell differentiation
GO:0051240	0.557	positive regulation of multicellular organismal process
GO:0009987	0.426	cellular process
GO:0050896	0.306	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.901	nuclear lumen
GO:0005737	0.896	cytoplasm
GO:0005654	0.714	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]