StarFunc result for job id Q9BTT4

User Input

>input (135 residues)
MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHD
ITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPED
MAKYRSIRGEDHPPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A7K6	0.943	0.943	1.078E-19	135	0.993	0.993	D4A7K6.pdb.gz	D4A7K6_RAT Mediator of RNA polymerase II transcription subunit 10 OS=Rattus norvegicus OX=10116 GN=Med10 PE=3 SV=1
2	AFDB:Q0VIA1	0.970	0.977	3.053E-17	134	0.881	0.888	Q0VIA1.pdb.gz	MED10_DANRE Mediator of RNA polymerase II transcription subunit 10 OS=Danio rerio OX=7955 GN=med10 PE=2 SV=1
3	PDB:7nvrk	0.831	0.842	5.803E-17	133	0.978	0.992	7nvrk.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
4	AFDB:Q9GYU7	0.856	0.867	8.014E-13	133	0.578	0.586	Q9GYU7.pdb.gz	MED10_DROME Mediator of RNA polymerase II transcription subunit 10 OS=Drosophila melanogaster OX=7227 GN=MED10 PE=1 SV=1
5	AFDB:F4HPA7	0.863	0.630	1.746E-8	189	0.326	0.233	F4HPA7.pdb.gz	MD10B_ARATH Mediator of RNA polymerase II transcription subunit 10b OS=Arabidopsis thaliana OX=3702 GN=MED10B PE=1 SV=1
6	AFDB:Q9FHZ2	0.853	0.633	2.238E-8	186	0.363	0.263	Q9FHZ2.pdb.gz	MD10A_ARATH Mediator of RNA polymerase II transcription subunit 10a OS=Arabidopsis thaliana OX=3702 GN=MED10A PE=1 SV=1
7	PDB:5n9jB	0.837	0.849	1.872E-6	133	0.222	0.226	5n9jB.pdb.gz
8	AFDB:P87310	0.787	0.744	4.105E-6	144	0.230	0.215	P87310.pdb.gz	MED10_SCHPO Mediator of RNA polymerase II transcription subunit 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med10 PE=1 SV=2
9	AFDB:Q06213	0.842	0.732	1.710E-5	157	0.267	0.229	Q06213.pdb.gz	MED10_YEAST Mediator of RNA polymerase II transcription subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUT2 PE=1 SV=1
10	PDB:5oqmk	0.799	0.845	2.871E-5	127	0.222	0.236	5oqmk.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
11	AFDB:P38304	0.402	0.253	2.927E-2	223	0.148	0.090	P38304.pdb.gz	MED8_YEAST Mediator of RNA polymerase II transcription subunit 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MED8 PE=1 SV=3
12	PDB:4h63H	0.383	0.305	4.340E-2	174	0.156	0.121	4h63H.pdb.gz
13	PDB:5n9jU	0.383	0.275	5.563E-2	198	0.133	0.091	5n9jU.pdb.gz
14	AFDB:Q6BER6	0.291	0.299	1.220E-1	130	0.148	0.154	Q6BER6.pdb.gz	MED21_CAEEL Mediator of RNA polymerase II transcription subunit 21 OS=Caenorhabditis elegans OX=6239 GN=mdt-21 PE=1 SV=1
15	AFDB:Q08278	0.442	0.288	1.563E-1	222	0.156	0.095	Q08278.pdb.gz	MED7_YEAST Mediator of RNA polymerase II transcription subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MED7 PE=1 SV=1
16	PDB:7lbmh	0.236	0.214	2.792E-1	158	0.163	0.139	7lbmh.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
17	PDB:7enal	0.397	0.423	2.971E-1	126	0.119	0.127	7enal.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
18	PDB:5oqmn	0.306	0.304	4.310E-1	136	0.148	0.147	5oqmn.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
19	PDB:5svaU	0.348	0.308	4.880E-1	156	0.156	0.135	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
20	PDB:7enag	0.360	0.297	5.525E-1	166	0.111	0.090	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BTT4	7.28e-98	278	135	1.000	1.000	MED10_HUMAN Mediator of RNA polymerase II transcription subunit 10 OS=Homo sapiens OX=9606 GN=MED10 PE=1 SV=1
2	D4A7K6	4.60e-97	276	135	0.993	0.993	D4A7K6_RAT Mediator of RNA polymerase II transcription subunit 10 OS=Rattus norvegicus OX=10116 GN=Med10 PE=3 SV=1
3	Q9CXU0	4.60e-97	276	135	0.993	0.993	MED10_MOUSE Mediator of RNA polymerase II transcription subunit 10 OS=Mus musculus OX=10090 GN=Med10 PE=1 SV=1
4	Q0VIA1	3.40e-85	246	134	0.881	0.888	MED10_DANRE Mediator of RNA polymerase II transcription subunit 10 OS=Danio rerio OX=7955 GN=med10 PE=2 SV=1
5	Q9GYU7	5.46e-52	162	133	0.578	0.586	MED10_DROME Mediator of RNA polymerase II transcription subunit 10 OS=Drosophila melanogaster OX=7227 GN=MED10 PE=1 SV=1
6	Q9FHZ2	1.07e-22	89.7	186	0.378	0.274	MD10A_ARATH Mediator of RNA polymerase II transcription subunit 10a OS=Arabidopsis thaliana OX=3702 GN=MED10A PE=1 SV=1
7	F4HPA7	2.35e-21	86.7	189	0.326	0.233	MD10B_ARATH Mediator of RNA polymerase II transcription subunit 10b OS=Arabidopsis thaliana OX=3702 GN=MED10B PE=1 SV=1
8	Q06213	3.83e-11	59.3	157	0.281	0.242	MED10_YEAST Mediator of RNA polymerase II transcription subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUT2 PE=1 SV=1
9	P87310	1.70e-10	57.4	144	0.215	0.201	MED10_SCHPO Mediator of RNA polymerase II transcription subunit 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med10 PE=1 SV=2
10	M9PFR6	0.86	31.2	188	0.170	0.122	M9PFR6_DROME Multiprotein bridging factor 1, isoform E OS=Drosophila melanogaster OX=7227 GN=mbf1 PE=1 SV=1
11	Q9XZ03	1.1	30.4	145	0.170	0.159	Q9XZ03_DROME Multiprotein Bridging Factor 1 OS=Drosophila melanogaster OX=7227 GN=mbf1 PE=1 SV=1
12	H9L9E5	1.2	31.2	556	0.244	0.059	COP_ELETR Sesquiterpene synthase Cop OS=Eleutherococcus trifoliatus OX=46385 GN=COP PE=1 SV=1
13	P06131	3.7	29.6	684	0.133	0.026	FDHA_METFO Formate dehydrogenase subunit alpha OS=Methanobacterium formicicum OX=2162 GN=fdhA PE=1 SV=1
14	Q5BEJ7	3.9	29.6	440	0.081	0.025	AFOD_EMENI FAD-dependent monooxygenase afoD OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afoD PE=1 SV=1
15	Q9FT77	4.1	29.6	796	0.193	0.033	RLM3_ARATH Disease resistance protein RLM3 OS=Arabidopsis thaliana OX=3702 GN=RLM3 PE=2 SV=1
16	C0PUF7	7.0	28.9	501	0.141	0.038	C0PUF7_SALSA Signal transducer and activator of transcription 3 (Fragment) OS=Salmo salar OX=8030 GN=STAT3 PE=2 SV=1
17	P86839	8.1	28.5	1265	0.089	0.009	NEST_DANRE Nestin OS=Danio rerio OX=7955 GN=nes PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11433 DUF3198	1.4e+02	13.8	Protein of unknown function (DUF3198)
2	PF09748 Med10	5.5e-33	124.9	Transcription factor subunit Med10 of Mediator complex
3	PF03979 Sigma70_r1_1	1.3e+02	14.1	Sigma-70 factor, region 1.1
4	PF18213 SUB1_ProdP9	3.5e+02	12.4	SUB1 protease Prodomain ProdP9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008570905.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008572647.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
2	482537.XP_008579333.1	0.999	Mediator of RNA polymerase II transcription subunit 31
3	482537.XP_008568981.1	0.998	Mediator of RNA polymerase II transcription subunit 6 isoform X1
4	482537.XP_008579983.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 13 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
5	482537.XP_008589831.1	0.998	Mediator of RNA polymerase II transcription subunit 21 isoform X1
6	482537.XP_008585319.1	0.997	Mediator of RNA polymerase II transcription subunit 4 isoform X1
7	482537.XP_008585727.1	0.997	Mediator of RNA polymerase II transcription subunit 18 isoform X1
8	482537.XP_008586448.1	0.997	Mediator of RNA polymerase II transcription subunit 28
9	482537.XP_008568299.1	0.996	Mediator of RNA polymerase II transcription subunit 11
10	482537.XP_008579117.1	0.996	Cyclin-dependent kinase 8
11	482537.XP_008578146.1	0.995	Mediator of RNA polymerase II transcription subunit 19 isoform X1
12	482537.XP_008580495.1	0.995	Mediator of RNA polymerase II transcription subunit 8
13	482537.XP_008564462.1	0.994	Mediator of RNA polymerase II transcription subunit 9
14	482537.XP_008576428.1	0.994	cyclin-C isoform X1
15	482537.XP_008578898.1	0.994	Mediator of RNA polymerase II transcription subunit 22
16	482537.XP_008572829.1	0.993	Mediator of RNA polymerase II transcription subunit 14 isoform X1
17	482537.XP_008576648.1	0.993	Mediator of RNA polymerase II transcription subunit 27 isoform X1
18	482537.XP_008580241.1	0.993	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
19	482537.XP_008589737.1	0.993	Mediator of RNA polymerase II transcription subunit 30
20	482537.XP_008565786.1	0.992	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.847	catalytic activity
GO:0140096	0.816	catalytic activity, acting on a protein
GO:0016740	0.631	transferase activity
GO:0019787	0.499	ubiquitin-like protein transferase activity
GO:0061659	0.492	ubiquitin-like protein ligase activity
GO:0061630	0.477	ubiquitin protein ligase activity
GO:0140110	0.371	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.959	regulation of metabolic process
GO:0050794	0.953	regulation of cellular process
GO:0048518	0.953	positive regulation of biological process
GO:0060255	0.946	regulation of macromolecule metabolic process
GO:0071704	0.942	organic substance metabolic process
GO:0006355	0.941	regulation of DNA-templated transcription
GO:0044238	0.930	primary metabolic process
GO:0048522	0.925	positive regulation of cellular process
GO:0009893	0.912	positive regulation of metabolic process
GO:0006807	0.908	nitrogen compound metabolic process
GO:0006357	0.892	regulation of transcription by RNA polymerase II
GO:0010604	0.864	positive regulation of macromolecule metabolic process
GO:0043170	0.860	macromolecule metabolic process
GO:0051173	0.846	positive regulation of nitrogen compound metabolic process
GO:0031325	0.842	positive regulation of cellular metabolic process
GO:0045935	0.811	positive regulation of nucleobase-containing compound metabolic process
GO:0032501	0.810	multicellular organismal process
GO:0009891	0.810	positive regulation of biosynthetic process
GO:0045893	0.761	positive regulation of DNA-templated transcription
GO:0032502	0.708	developmental process
GO:0098727	0.682	maintenance of cell number
GO:0045944	0.671	positive regulation of transcription by RNA polymerase II
GO:0035019	0.562	somatic stem cell population maintenance
GO:0009987	0.463	cellular process
GO:0044237	0.342	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0090575	0.952	RNA polymerase II transcription regulator complex
GO:0070847	0.894	core mediator complex
GO:0016592	0.799	mediator complex
GO:1902494	0.716	catalytic complex
GO:1990234	0.700	transferase complex
GO:0140535	0.682	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.631	Transferases.

[back to server]