StarFunc result for job id Q9BTV5

User Input

>input (496 residues)
MEEQREALRKIIKTLAVKNEEIQSFIYSLKQMLLNVEANSAKVQEDLEAEFQSLFSLLEE
LKEGMLMKIKQDRASRTYELQNQLAACTRALESSEELLETANQTLQAMDSEDFPQAAKQI
KDGVTMAPAFRLSLKAKVSDNMSHLMVDFAQERQMLQALKFLPVPSAPVIDLAESLVADN
CVTLVWRMPDEDSKIDHYVLEYRRTNFEGPPRLKEDQPWMVIEGIRQTEYTLTGLKFDMK
YMNFRVKACNKAVAGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDI
KAREKDGKGRTASPINSPARGTPSPKRMPSGRGGRDRFTAESYTVLGDTLIDGGEHYWEV
RYEPDSKAFGVGVAYRSLGRFEQLGKTAASWCLHVNNWLQVSFTAKHANKVKVLDAPVPD
CLGVHCDFHQGLLSFYNARTKQVLHTFKTRFTQPLLPAFTVWCGSFQVTTGLQVPSAVRC
LQKRGSATSSSNTSLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BTV5	1.000	1.000	2.664E-90	496	1.000	1.000	Q9BTV5.pdb.gz	FSD1_HUMAN Fibronectin type III and SPRY domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FSD1 PE=1 SV=1
2	AFDB:Q1LY10	0.924	0.926	9.474E-73	495	0.679	0.681	Q1LY10.pdb.gz	FSD1_DANRE Fibronectin type III and SPRY domain-containing protein 1 OS=Danio rerio OX=7955 GN=fsd1 PE=3 SV=1
3	AFDB:O70583	0.443	0.339	7.175E-35	680	0.294	0.215	O70583.pdb.gz	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
4	AFDB:Q9UJV3	0.419	0.307	6.208E-33	735	0.284	0.192	Q9UJV3.pdb.gz	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
5	AFDB:A1L4K1	0.348	0.235	1.880E-28	749	0.228	0.151	A1L4K1.pdb.gz	FSD2_HUMAN Fibronectin type III and SPRY domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FSD2 PE=1 SV=1
6	AFDB:Q8BZ52	0.347	0.244	2.479E-27	716	0.214	0.148	Q8BZ52.pdb.gz	FSD2_MOUSE Fibronectin type III and SPRY domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fsd2 PE=1 SV=3
7	AFDB:Q91ZY8	0.307	0.220	5.858E-27	710	0.214	0.149	Q91ZY8.pdb.gz	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
8	AFDB:Q505D9	0.336	0.226	1.243E-26	768	0.218	0.141	Q505D9.pdb.gz	TRI67_MOUSE Tripartite motif-containing protein 67 OS=Mus musculus OX=10090 GN=Trim67 PE=2 SV=1
9	AFDB:A0A0G2JXN2	0.466	0.320	2.016E-26	759	0.240	0.157	A0A0G2JXN2.pdb.gz	TRI46_RAT Tripartite motif-containing protein 46 OS=Rattus norvegicus OX=10116 GN=Trim46 PE=1 SV=2
10	AFDB:M9MRI4	0.302	0.210	2.369E-26	740	0.212	0.142	M9MRI4.pdb.gz	TRIM9_DROME E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1
11	PDB:7y4sA	0.291	0.415	3.395E-12	343	0.147	0.213	7y4sA.pdb.gz
12	PDB:4b3nA	0.269	0.241	1.826E-9	557	0.067	0.059	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:7ccbA	0.262	0.740	1.218E-6	164	0.048	0.146	7ccbA.pdb.gz
14	PDB:6m5yA	0.191	0.308	1.442E-5	270	0.062	0.115	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
15	PDB:6venO	0.225	0.343	3.061E-5	315	0.062	0.098	6venO.pdb.gz	Structural basis for COMPASS recognition of an H2B-ubiquitinated nucleosome.
16	PDB:4ga9A	0.171	0.495	4.226E-5	134	0.052	0.194	4ga9A.pdb.gz	Gal-1 structure analysis
17	PDB:7nscA	0.271	0.460	4.459E-5	276	0.050	0.091	7nscA.pdb.gz
18	PDB:3vv1A	0.169	0.452	6.854E-5	141	0.028	0.099	3vv1A.pdb.gz	Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6
19	PDB:7tdgA	0.175	0.024	1.454E-4	4134	0.034	0.004	7tdgA.pdb.gz	Ca 2+ -inactivation of the mammalian ryanodine receptor type 1 in a lipidic environment revealed by cryo-EM.
20	PDB:6swy1	0.188	0.174	1.535E-4	542	0.038	0.035	6swy1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q1LY10	0.0	709	495	0.685	0.687	FSD1_DANRE Fibronectin type III and SPRY domain-containing protein 1 OS=Danio rerio OX=7955 GN=fsd1 PE=3 SV=1
2	Q9BTV5	0.0	1039	496	1.000	1.000	FSD1_HUMAN Fibronectin type III and SPRY domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FSD1 PE=1 SV=1
3	O70583	3.06e-62	217	680	0.308	0.225	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
4	O15344	5.63e-62	216	667	0.294	0.219	TRI18_HUMAN E3 ubiquitin-protein ligase Midline-1 OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
5	Q9UJV3	1.37e-54	197	735	0.296	0.200	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
6	Q7TNM2	7.80e-28	119	759	0.214	0.140	TRI46_MOUSE Tripartite motif-containing protein 46 OS=Mus musculus OX=10090 GN=Trim46 PE=1 SV=1
7	A0A0G2JXN2	7.94e-28	119	759	0.214	0.140	TRI46_RAT Tripartite motif-containing protein 46 OS=Rattus norvegicus OX=10116 GN=Trim46 PE=1 SV=2
8	C9J453	7.65e-26	112	483	0.157	0.161	C9J453_HUMAN RING-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
9	Q80WG7	4.41e-22	102	729	0.256	0.174	TRI36_MOUSE E3 ubiquitin-protein ligase Trim36 OS=Mus musculus OX=10090 GN=Trim36 PE=1 SV=2
10	Q9NQ86	4.44e-22	102	728	0.250	0.170	TRI36_HUMAN E3 ubiquitin-protein ligase TRIM36 OS=Homo sapiens OX=9606 GN=TRIM36 PE=1 SV=2
11	Q505D9	9.79e-20	95.1	768	0.248	0.160	TRI67_MOUSE Tripartite motif-containing protein 67 OS=Mus musculus OX=10090 GN=Trim67 PE=2 SV=1
12	B1GRL4	9.22e-19	92.0	751	0.246	0.162	B1GRL4_CAEEL E3 ubiquitin-protein ligase TRIM9 OS=Caenorhabditis elegans OX=6239 GN=madd-2 PE=4 SV=1
13	Q9C026	7.50e-18	89.0	710	0.200	0.139	TRIM9_HUMAN E3 ubiquitin-protein ligase TRIM9 OS=Homo sapiens OX=9606 GN=TRIM9 PE=1 SV=1
14	Q9UAQ3	1.24e-17	88.6	765	0.254	0.165	Q9UAQ3_CAEEL E3 ubiquitin-protein ligase TRIM9 OS=Caenorhabditis elegans OX=6239 GN=madd-2 PE=4 SV=2
15	Q91ZY8	4.30e-17	86.7	710	0.232	0.162	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
16	Q70KF4	2.00e-14	79.0	3739	0.171	0.023	CMYA5_MOUSE Cardiomyopathy-associated protein 5 OS=Mus musculus OX=10090 GN=Cmya5 PE=1 SV=2
17	M9MRI4	1.15e-13	75.9	740	0.220	0.147	TRIM9_DROME E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1
18	A1L4K1	1.74e-13	75.5	749	0.131	0.087	FSD2_HUMAN Fibronectin type III and SPRY domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FSD2 PE=1 SV=1
19	Q91WK1	2.57e-13	71.2	207	0.097	0.232	SPRY4_MOUSE SPRY domain-containing protein 4 OS=Mus musculus OX=10090 GN=Spryd4 PE=1 SV=1
20	Q8N3K9	2.65e-13	75.5	4069	0.171	0.021	CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens OX=9606 GN=CMYA5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18568 COS	2.3e+02	13.3	TRIM C-terminal subgroup One Signature domain
2	PF16303 DUF4945	4.7e+02	12.2	Domain of unknown function (DUF4945)
3	PF00041 fn3	0.005	28.5	Fibronectin type III domain
4	PF00622 SPRY	5.8e-07	41.0	SPRY domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000221856

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307975	0.692	Histidine protein methyltransferase 1 homolog
2	9606.ENSP00000388942	0.675	Secernin-1
3	9606.ENSP00000445868	0.636	B-cell CLL/lymphoma 7 protein family member A
4	9606.ENSP00000311479	0.608	Uncharacterized protein C11orf86
5	9606.ENSP00000419782	0.587	Cyclin-dependent-like kinase 5
6	9606.ENSP00000251413	0.571	Tubulin gamma-1 chain
7	9606.ENSP00000263182	0.536	Gamma-butyrobetaine dioxygenase
8	9606.ENSP00000429986	0.530	Transcription and mRNA export factor ENY2
9	9606.ENSP00000309330	0.529	Zinc finger protein 680
10	9606.ENSP00000468531	0.521	Zinc finger protein 177
11	9606.ENSP00000415070	0.518	ZNF559-ZNF177 readthrough
12	9606.ENSP00000346839	0.501	Fibronectin type III domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0008017	1.000	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0071840	0.858	cellular component organization or biogenesis
GO:0016043	0.851	cellular component organization
GO:0006996	0.778	organelle organization
GO:0010564	0.773	regulation of cell cycle process
GO:0032886	0.747	regulation of microtubule-based process
GO:0007017	0.683	microtubule-based process
GO:0051302	0.649	regulation of cell division
GO:0033043	0.641	regulation of organelle organization
GO:0032465	0.627	regulation of cytokinesis
GO:0000226	0.607	microtubule cytoskeleton organization
GO:0090224	0.600	regulation of spindle organization
GO:0097435	0.577	supramolecular fiber organization
GO:0060236	0.568	regulation of mitotic spindle organization
GO:0031122	0.522	cytoplasmic microtubule organization
GO:0048518	0.341	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005856	0.949	cytoskeleton
GO:0005737	0.911	cytoplasm
GO:0015630	0.902	microtubule cytoskeleton
GO:0099080	0.801	supramolecular complex
GO:0099512	0.785	supramolecular fiber
GO:0005815	0.785	microtubule organizing center
GO:0005813	0.783	centrosome
GO:0099513	0.748	polymeric cytoskeletal fiber
GO:0043227	0.723	membrane-bounded organelle
GO:0005874	0.708	microtubule
GO:0005829	0.691	cytosol
GO:0043231	0.629	intracellular membrane-bounded organelle
GO:0005634	0.315	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]