StarFunc result for job id Q9BU40

User Input

>input (456 residues)
MRKKWKMGGMKYIFSLLFFLLLEGGKTEQVKHSETYCMFQDKKYRVGERWHPYLEPYGLV
YCVNCICSENGNVLCSRVRCPNVHCLSPVHIPHLCCPRCPDSLPPVNNKVTSKSCEYNGT
TYQHGELFVAEGLFQNRQPNQCTQCSCSEGNVYCGLKTCPKLTCAFPVSVPDSCCRVCRG
DGELSWEHSDGDIFRQPANREARHSYHRSHYDPPPSRQAGGLSRFPGARSHRGALMDSQQ
ASGTIVQIVINNKHKHGQVCVSNGKTYSHGESWHPNLRAFGIVECVLCTCNVTKQECKKI
HCPNRYPCKYPQKIDGKCCKVCPGKKAKELPGQSFDNKGYFCGEETMPVYESVFMEDGET
TRKIALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKIFT
EGEAQISQMCSSRVCRTELEDLVKVLYLERSEKGHC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BU40	1.000	1.000	3.645E-83	456	1.000	1.000	Q9BU40.pdb.gz	CRDL1_HUMAN Chordin-like protein 1 OS=Homo sapiens OX=9606 GN=CHRDL1 PE=1 SV=2
2	AFDB:Q76LD0	0.272	0.277	2.479E-71	447	0.873	0.890	Q76LD0.pdb.gz	CRDL1_RAT Chordin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chrdl1 PE=2 SV=2
3	AFDB:Q8VEA6	0.251	0.266	1.518E-37	426	0.355	0.380	Q8VEA6.pdb.gz	CRDL2_MOUSE Chordin-like protein 2 OS=Mus musculus OX=10090 GN=Chrdl2 PE=1 SV=1
4	AFDB:B4XEZ3	0.251	0.252	7.795E-36	454	0.375	0.377	B4XEZ3.pdb.gz	B4XEZ3_DANRE Chordin-like 2 OS=Danio rerio OX=7955 GN=CHL PE=2 SV=1
5	AFDB:F1NWN4	0.107	0.044	2.499E-2	1196	0.105	0.040	F1NWN4.pdb.gz
6	PDB:3a7aA	0.083	0.106	1.800E-1	337	0.022	0.030	3a7aA.pdb.gz	Global conformational change associated with the two-step reaction catalyzed by Escherichia coli lipoate-protein ligase A.
7	PDB:3kq0A	0.077	0.186	2.005E-1	175	0.007	0.017	3kq0A.pdb.gz	The 1.8-A crystal structure of alpha1-acid glycoprotein (Orosomucoid) solved by UV RIP reveals the broad drug-binding activity of this human plasma lipocalin.
8	PDB:6x0lP	0.095	0.093	2.005E-1	474	0.024	0.023	6x0lP.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
9	AFDB:Q8MT36	0.094	0.045	2.542E-1	1427	0.088	0.028	Q8MT36.pdb.gz	NSD_DROME Nuclear receptor binding SET domain protein OS=Drosophila melanogaster OX=7227 GN=NSD PE=1 SV=2
10	PDB:7b9vp	0.074	0.278	3.259E-1	77	0.018	0.104	7b9vp.pdb.gz	Structural basis for conformational equilibrium of the catalytic spliceosome.
11	PDB:3bxoA	0.087	0.160	3.831E-1	236	0.022	0.042	3bxoA.pdb.gz	Three-Dimensional Structure of DesVI from Streptomyces venezuelae: A Sugar N,N-Dimethyltransferase Required for dTDP-Desosamine Biosynthesis.
12	PDB:2wzpA	0.072	0.111	4.043E-1	266	0.024	0.041	2wzpA.pdb.gz
13	AFDB:Q9VTR6	0.075	0.025	4.132E-1	1713	0.096	0.026	Q9VTR6.pdb.gz	Q9VTR6_DROME Pericardin OS=Drosophila melanogaster OX=7227 GN=prc PE=1 SV=2
14	AFDB:P08553	0.067	0.040	4.857E-1	848	0.079	0.042	P08553.pdb.gz	NFM_MOUSE Neurofilament medium polypeptide OS=Mus musculus OX=10090 GN=Nefm PE=1 SV=4
15	PDB:3jb9H	0.092	0.322	5.589E-1	76	0.009	0.053	3jb9H.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
16	PDB:5xqiC	0.054	0.087	5.589E-1	254	0.031	0.055	5xqiC.pdb.gz
17	PDB:3typB	0.096	0.254	5.899E-1	150	0.026	0.080	3typB.pdb.gz
18	PDB:4oqdC	0.094	0.169	6.226E-1	241	0.024	0.046	4oqdC.pdb.gz	Production of a novel N-monomethylated dideoxysugar.
19	AFDB:A0A024QZE0	0.079	0.061	7.086E-1	651	0.149	0.104	A0A024QZE0.pdb.gz
20	AFDB:P53882	0.072	0.057	1.091	636	0.118	0.085	P53882.pdb.gz	TDA7_YEAST Topoisomerase I damage affected protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TDA7 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q76LD0	0.0	830	447	0.873	0.890	CRDL1_RAT Chordin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chrdl1 PE=2 SV=2
2	Q920C1	0.0	845	447	0.890	0.908	CRDL1_MOUSE Chordin-like protein 1 OS=Mus musculus OX=10090 GN=Chrdl1 PE=1 SV=1
3	Q9BU40	0.0	948	456	1.000	1.000	CRDL1_HUMAN Chordin-like protein 1 OS=Homo sapiens OX=9606 GN=CHRDL1 PE=1 SV=2
4	Q6WN34	1.65e-99	306	429	0.351	0.373	CRDL2_HUMAN Chordin-like protein 2 OS=Homo sapiens OX=9606 GN=CHRDL2 PE=1 SV=1
5	B4XEZ3	7.70e-96	298	454	0.375	0.377	B4XEZ3_DANRE Chordin-like 2 OS=Danio rerio OX=7955 GN=CHL PE=2 SV=1
6	Q8VEA6	8.81e-93	289	426	0.360	0.385	CRDL2_MOUSE Chordin-like protein 2 OS=Mus musculus OX=10090 GN=Chrdl2 PE=1 SV=1
7	Q7T3Q2	1.67e-14	78.6	1027	0.195	0.087	CRIM1_DANRE Cysteine-rich motor neuron 1 protein OS=Danio rerio OX=7955 GN=crim1 PE=2 SV=1
8	O57472	1.99e-13	75.1	940	0.107	0.052	CHRD_DANRE Chordin OS=Danio rerio OX=7955 GN=chd PE=2 SV=1
9	Q8N8U9	4.71e-13	73.6	685	0.211	0.140	BMPER_HUMAN BMP-binding endothelial regulator protein OS=Homo sapiens OX=9606 GN=BMPER PE=1 SV=3
10	Q91713	1.63e-11	68.9	941	0.116	0.056	CHRD_XENLA Chordin OS=Xenopus laevis OX=8355 GN=chrd PE=1 SV=1
11	Q9NZV1	1.69e-11	68.9	1036	0.149	0.066	CRIM1_HUMAN Cysteine-rich motor neuron 1 protein OS=Homo sapiens OX=9606 GN=CRIM1 PE=1 SV=1
12	Q3U492	3.94e-10	64.7	1550	0.118	0.035	KCP_MOUSE Kielin/chordin-like protein OS=Mus musculus OX=10090 GN=Kcp PE=1 SV=2
13	Q9Z0E2	4.04e-10	64.7	948	0.154	0.074	CHRD_MOUSE Chordin OS=Mus musculus OX=10090 GN=Chrd PE=1 SV=1
14	Q8C8N3	1.69e-09	61.2	324	0.101	0.142	VWC2_MOUSE Brorin OS=Mus musculus OX=10090 GN=Vwc2 PE=1 SV=1
15	Q8CJ69	2.63e-09	61.6	685	0.211	0.140	BMPER_MOUSE BMP-binding endothelial regulator protein OS=Mus musculus OX=10090 GN=Bmper PE=1 SV=1
16	Q96DN2	4.00e-09	61.2	955	0.118	0.057	VWCE_HUMAN von Willebrand factor C and EGF domain-containing protein OS=Homo sapiens OX=9606 GN=VWCE PE=1 SV=2
17	Q2TAL6	4.67e-09	60.1	325	0.101	0.142	VWC2_HUMAN Brorin OS=Homo sapiens OX=9606 GN=VWC2 PE=1 SV=1
18	A6H8K2	2.79e-08	58.5	668	0.202	0.138	A6H8K2_DANRE BMP-binding endothelial regulator protein precursor OS=Danio rerio OX=7955 GN=cvl2 PE=2 SV=1
19	A0A0R4IQJ3	1.01e-07	57.4	4003	0.110	0.012	A0A0R4IQJ3_DANRE Extracellular matrix protein FRAS1 isoform X1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=2
20	Q9GYX3	3.59e-07	55.1	751	0.092	0.056	Q9GYX3_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19548 CHRDL_1_2_C	1.9e-67	236.5	Chordin-like protein 1/2 C-terminal
2	PF07383 DUF1496	21	16.1	Protein of unknown function (DUF1496)
3	PF17043 MAT1-1-2	2.2e+02	13.0	Mating type protein 1-1-2 of unknown function
4	PF00093 VWC	2.3e-22	90.4	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361112

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245451	0.966	Bone morphogenetic protein 4
2	9606.ENSP00000368104	0.950	Bone morphogenetic protein 2
3	9606.ENSP00000401907	0.943	Bone morphogenetic protein receptor type-1B
4	9606.ENSP00000361107	0.939	Bone morphogenetic protein receptor type-1A
5	9606.ENSP00000308219	0.928	RGM domain family member B
6	9606.ENSP00000364683	0.928	BMP and activin membrane-bound inhibitor homolog
7	9606.ENSP00000363708	0.923	Bone morphogenetic protein receptor type-2
8	9606.ENSP00000452126	0.918	Repulsive guidance molecule A
9	9606.ENSP00000337014	0.903	Hemojuvelin
10	9606.ENSP00000304930	0.691	Sclerostin domain-containing protein 1
11	9606.ENSP00000305334	0.673	Follistatin-related protein 5
12	9606.ENSP00000262120	0.616	Twisted gastrulation protein homolog 1
13	9606.ENSP00000478319	0.574	Gremlin-1
14	9606.ENSP00000318650	0.572	Gremlin-2
15	9606.ENSP00000328181	0.572	Noggin
16	9606.ENSP00000301691	0.565	Sclerostin
17	9606.ENSP00000379204	0.525	Bone morphogenetic protein 7
18	9606.ENSP00000378957	0.520	Microfibril-associated glycoprotein 4
19	9606.ENSP00000295633	0.502	Follistatin-related protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0036122	0.998	BMP binding
GO:0050431	0.990	transforming growth factor beta binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0007275	0.985	multicellular organism development
GO:0048731	0.926	system development
GO:0050794	0.922	regulation of cellular process
GO:0007399	0.907	nervous system development
GO:0050896	0.857	response to stimulus
GO:0048583	0.844	regulation of response to stimulus
GO:0048523	0.832	negative regulation of cellular process
GO:0090092	0.830	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0030154	0.823	cell differentiation
GO:0051716	0.775	cellular response to stimulus
GO:0048513	0.734	animal organ development
GO:0007167	0.623	enzyme-linked receptor protein signaling pathway
GO:0071363	0.557	cellular response to growth factor stimulus
GO:0007178	0.557	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009968	0.535	negative regulation of signal transduction
GO:0048518	0.504	positive regulation of biological process
GO:0048522	0.493	positive regulation of cellular process
GO:0090287	0.462	regulation of cellular response to growth factor stimulus
GO:0048880	0.462	sensory system development
GO:0071773	0.436	cellular response to BMP stimulus
GO:0030509	0.400	BMP signaling pathway
GO:0090101	0.340	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0050793	0.336	regulation of developmental process
GO:0030510	0.334	regulation of BMP signaling pathway
GO:0019222	0.326	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005622	0.833	intracellular anatomical structure
GO:0070013	0.792	intracellular organelle lumen
GO:0012505	0.747	endomembrane system
GO:0043231	0.679	intracellular membrane-bounded organelle
GO:0005783	0.582	endoplasmic reticulum
GO:0005788	0.354	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]