StarFunc result for job id Q9BUE6

User Input

>input (129 residues)
MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGL
SYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT
CGCGESFNI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:I3ITR1	0.931	0.931	3.520E-25	129	0.961	0.961	I3ITR1.pdb.gz	I3ITR1_MOUSE cDNA sequence AK157302 OS=Mus musculus OX=10090 GN=AK157302 PE=3 SV=1
2	AFDB:Q4QRC6	0.881	0.881	1.718E-23	129	0.845	0.845	Q4QRC6.pdb.gz	ISCA1_DANRE Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Danio rerio OX=7955 GN=isca1 PE=2 SV=1
3	AFDB:Q8T3X9	0.955	0.948	2.289E-21	130	0.736	0.731	Q8T3X9.pdb.gz	ISCA1_DROME Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MagR PE=1 SV=1
4	AFDB:Q07821	0.828	0.439	2.547E-15	250	0.457	0.236	Q07821.pdb.gz	ISA1_YEAST Iron-sulfur assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISA1 PE=1 SV=1
5	AFDB:P78859	0.868	0.601	7.875E-15	190	0.372	0.253	P78859.pdb.gz	ISA1_SCHPO Iron-sulfur assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=isa1 PE=2 SV=1
6	AFDB:B7J5X1	0.761	0.908	3.186E-13	107	0.318	0.383	B7J5X1.pdb.gz	B7J5X1_ACIF2 Iron-binding protein IscA OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) OX=243159 GN=iscA PE=3 SV=1
7	AFDB:Q57X28	0.750	0.366	1.189E-12	272	0.426	0.202	Q57X28.pdb.gz	Q57X28_TRYB2 FeS cluster biogenesis domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.150 PE=4 SV=1
8	AFDB:P0AAC8	0.781	0.935	2.861E-12	107	0.310	0.374	P0AAC8.pdb.gz	ISCA_ECOLI Iron-binding protein IscA OS=Escherichia coli (strain K12) OX=83333 GN=iscA PE=1 SV=1
9	AFDB:P77667	0.770	0.811	3.453E-12	122	0.318	0.336	P77667.pdb.gz	SUFA_ECOLI Protein SufA OS=Escherichia coli (strain K12) OX=83333 GN=sufA PE=1 SV=1
10	AFDB:Q9XIK3	0.744	0.546	2.413E-11	180	0.295	0.211	Q9XIK3.pdb.gz	ISCAP_ARATH Iron-sulfur assembly protein IscA, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISCA PE=2 SV=2
11	PDB:2d2aA	0.718	0.803	4.104E-11	114	0.326	0.368	2d2aA.pdb.gz
12	PDB:1r94A	0.686	0.894	8.868E-10	97	0.256	0.340	1r94A.pdb.gz
13	PDB:1htoA	0.167	0.064	2.970E-1	477	0.085	0.023	1htoA.pdb.gz	Multicopy crystallographic refinement of a relaxed glutamine synthetase from Mycobacterium tuberculosis highlights flexible loops in the enzymatic mechanism and its regulation.
14	PDB:7pzyAL	0.167	0.244	3.367E-1	77	0.062	0.104	7pzyAL.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
15	PDB:4ic1D	0.189	0.132	4.905E-1	206	0.093	0.058	4ic1D.pdb.gz	Toroidal structure and DNA cleavage by the CRISPR-associated [4Fe-4S] cluster containing Cas4 nuclease SSO0001 from Sulfolobus solfataricus.
16	PDB:7w85A	0.199	0.074	4.905E-1	435	0.054	0.016	7w85A.pdb.gz
17	PDB:7c4cA	0.146	0.071	5.920E-1	332	0.054	0.021	7c4cA.pdb.gz	Structural basis for guide RNA trimming by RNase D ribonuclease in Trypanosoma brucei.
18	PDB:1f1hA	0.181	0.062	6.304E-1	468	0.070	0.019	1f1hA.pdb.gz	The crystal structure of phosphinothricin in the active site of glutamine synthetase illuminates the mechanism of enzymatic inhibition.
19	PDB:7sn8I	0.109	0.038	6.711E-1	634	0.132	0.027	7sn8I.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
20	PDB:3j79d	0.159	0.229	9.778E-1	72	0.078	0.139	3j79d.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BUE6	8.70e-93	265	129	1.000	1.000	ISCA1_HUMAN Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=ISCA1 PE=1 SV=1
2	Q9D924	6.79e-91	260	129	0.969	0.969	ISCA1_MOUSE Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Isca1 PE=2 SV=1
3	I3ITR1	6.52e-90	258	129	0.961	0.961	I3ITR1_MOUSE cDNA sequence AK157302 OS=Mus musculus OX=10090 GN=AK157302 PE=3 SV=1
4	Q4QRC6	4.07e-79	231	129	0.845	0.845	ISCA1_DANRE Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Danio rerio OX=7955 GN=isca1 PE=2 SV=1
5	Q8T3X9	3.50e-67	201	130	0.736	0.731	ISCA1_DROME Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MagR PE=1 SV=1
6	Q07821	8.74e-35	122	250	0.419	0.216	ISA1_YEAST Iron-sulfur assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISA1 PE=1 SV=1
7	P78859	4.05e-29	106	190	0.380	0.258	ISA1_SCHPO Iron-sulfur assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=isa1 PE=2 SV=1
8	B7J5X1	1.34e-26	97.4	107	0.326	0.393	B7J5X1_ACIF2 Iron-binding protein IscA OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) OX=243159 GN=iscA PE=3 SV=1
9	P0AAC8	2.26e-23	89.4	107	0.310	0.374	ISCA_ECOLI Iron-binding protein IscA OS=Escherichia coli (strain K12) OX=83333 GN=iscA PE=1 SV=1
10	P77667	3.51e-23	89.0	122	0.318	0.336	SUFA_ECOLI Protein SufA OS=Escherichia coli (strain K12) OX=83333 GN=sufA PE=1 SV=1
11	Q57X28	1.99e-20	85.5	272	0.419	0.199	Q57X28_TRYB2 FeS cluster biogenesis domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.150 PE=4 SV=1
12	Q9XIK3	6.39e-18	77.0	180	0.279	0.200	ISCAP_ARATH Iron-sulfur assembly protein IscA, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISCA PE=2 SV=2
13	P72731	9.07e-16	70.1	118	0.256	0.280	Y1417_SYNY3 Uncharacterized protein slr1417 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr1417 PE=3 SV=1
14	P0ACC3	1.46e-15	69.3	114	0.271	0.307	ERPA_ECOLI Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain K12) OX=83333 GN=erpA PE=1 SV=1
15	P74596	4.61e-13	62.8	113	0.279	0.319	Y1565_SYNY3 Uncharacterized protein slr1565 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr1565 PE=1 SV=1
16	P9WMN5	8.65e-12	59.7	118	0.202	0.220	Y2204_MYCTU Protein Rv2204c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2204c PE=1 SV=1
17	Q86U28	2.05e-08	51.6	154	0.256	0.214	ISCA2_HUMAN Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=ISCA2 PE=1 SV=2
18	O43045	4.26e-08	51.6	205	0.233	0.146	ISA2_SCHPO Iron-sulfur assembly protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=isa2 PE=3 SV=1
19	Q9DCB8	2.59e-07	48.9	154	0.194	0.162	ISCA2_MOUSE Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Isca2 PE=1 SV=2
20	Q12425	1.49e-06	47.0	185	0.256	0.178	ISA2_YEAST Iron-sulfur assembly protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISA2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01521 Fe-S_biosyn	7.2e-17	73.0	Iron-sulphur cluster biosynthesis

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008831307.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008847963.1	0.934	Iron-sulfur cluster assembly 2
2	1026970.XP_008841007.1	0.921	Glutaredoxin-related protein 5, mitochondrial
3	1026970.XP_008852369.1	0.898	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial isoform X1
4	1026970.XP_008824614.1	0.883	Glutaredoxin-related protein 5, mitochondrial-like
5	1026970.XP_008825248.1	0.818	IBA57 homolog, iron-sulfur cluster assembly
6	1026970.XP_008830292.1	0.813	Glutaredoxin-3
7	1026970.XP_008846277.1	0.807	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial isoform X1
8	1026970.XP_008847170.1	0.740	Iron-sulfur cluster assembly enzyme
9	1026970.XP_008848279.1	0.725	Ferredoxin 1 like
10	1026970.XP_008838982.1	0.706	NFS1, cysteine desulfurase
11	1026970.XP_008854364.1	0.664	Nuclear prelamin A recognition factor like
12	1026970.XP_008823000.1	0.662	bolA family member 3
13	1026970.XP_008831461.1	0.661	Lipoic acid synthetase
14	1026970.XP_008835900.1	0.649	ATP-binding cassette sub-family B member 7, mitochondrial isoform X1
15	1026970.XP_008850506.1	0.647	Frataxin, mitochondrial
16	1026970.XP_008829672.1	0.641	NADPH:adrenodoxin oxidoreductase, mitochondrial
17	1026970.XP_008829880.1	0.635	LYR motif containing 4
18	1026970.XP_008841941.1	0.630	bolA-like protein 1
19	1026970.XP_008822440.1	0.621	Nucleotide binding protein like
20	1026970.XP_008852035.1	0.617	grpE protein homolog 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0051536	0.920	iron-sulfur cluster binding
GO:0005506	0.823	iron ion binding
GO:0051537	0.812	2 iron, 2 sulfur cluster binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.994	cellular metabolic process
GO:0071704	0.990	organic substance metabolic process
GO:0006807	0.920	nitrogen compound metabolic process
GO:1901564	0.886	organonitrogen compound metabolic process
GO:0009058	0.799	biosynthetic process
GO:0046483	0.788	heterocycle metabolic process
GO:0044249	0.770	cellular biosynthetic process
GO:0033013	0.762	tetrapyrrole metabolic process
GO:1901362	0.740	organic cyclic compound biosynthetic process
GO:0033014	0.681	tetrapyrrole biosynthetic process
GO:0042168	0.680	heme metabolic process
GO:0006779	0.652	porphyrin-containing compound biosynthetic process
GO:0071840	0.459	cellular component organization or biogenesis
GO:0016043	0.444	cellular component organization
GO:0022607	0.425	cellular component assembly
GO:0044238	0.371	primary metabolic process
GO:0006783	0.339	heme biosynthetic process
GO:0006790	0.323	sulfur compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.988	intracellular organelle lumen
GO:0005759	0.842	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]