StarFunc result for job id Q9BUH8

User Input

>input (593 residues)
MEKLSALQEQKGELRKRLSYTTHKLEKLETEFDSTRHYLEIELRRAQEELEKVTEKLRRI
QSNYMALQRINQELEDKLYRMGQHYEEEKRALSHEIVALNSHLLEAKVTIDKLSEDNELY
RKDCNLAAQLLQCSQTYGRVHKVSELPSDFQERVSLHMEKHGCSLPSPLCHPAYADSVPT
CVIAKVLEKPDPASLSSRLSDASARDLAFCDGVEKPGPRPPYKGDIYCSDTALYCPEERR
RDRRPSVDAPVTDVGFLRAQNSTDSAAEEEEEAEAAAFPAGFQHEAFPSYAGSLPTSSSY
SSFSATSEEKEHAQASTLTASQQAIYLNSRDELFDRKPPATTYEGSPRFAKATAAVAAPL
EAEVAPGFGRTMSPYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRP
LSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGD
DLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGYAPSEGGDGDRLGVQLCGTASSPEPEQG
SRDSLEPSSMEASPEMHPAARLSPQQAFPRTGGSGLSRKDSLTKAQLYGTLLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1B0GVM0	0.272	0.208	3.402E-78	812	1.000	0.730	A0A1B0GVM0.pdb.gz	A0A1B0GVM0_HUMAN Brain enriched guanylate kinase associated OS=Homo sapiens OX=9606 GN=BEGAIN PE=1 SV=1
2	AFDB:O88881	0.308	0.301	7.117E-69	611	0.885	0.859	O88881.pdb.gz	BEGIN_RAT Brain-enriched guanylate kinase-associated protein OS=Rattus norvegicus OX=10116 GN=Begain PE=1 SV=1
3	AFDB:H3BJD6	0.183	0.096	3.313E-2	1292	0.160	0.074	H3BJD6.pdb.gz	H3BJD6_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
4	AFDB:Q9N5K3	0.129	0.126	4.406E-2	605	0.137	0.134	Q9N5K3.pdb.gz	SYP4_CAEEL Synaptonemal complex protein 4 OS=Caenorhabditis elegans OX=6239 GN=syp-4 PE=1 SV=1
5	AFDB:Q6VGS5	0.147	0.051	4.732E-2	2009	0.167	0.049	Q6VGS5.pdb.gz	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
6	AFDB:A0A0G2K490	0.120	0.061	5.457E-2	1360	0.191	0.083	A0A0G2K490.pdb.gz	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1
7	AFDB:Q9P219	0.175	0.060	6.759E-2	2028	0.180	0.053	Q9P219.pdb.gz	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
8	AFDB:F4HRT5	0.165	0.094	7.795E-2	1132	0.147	0.077	F4HRT5.pdb.gz	CRWN1_ARATH Protein CROWDED NUCLEI 1 OS=Arabidopsis thaliana OX=3702 GN=CRWN1 PE=1 SV=1
9	AFDB:O74689	0.172	0.173	8.989E-2	586	0.159	0.160	O74689.pdb.gz	NDE1_EMENI Nuclear distribution protein nudE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudE PE=1 SV=1
10	AFDB:A0A0R4IEP9	0.150	0.075	9.654E-2	1332	0.160	0.071	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
11	PDB:6hivCH	0.053	0.098	3.378	273	0.020	0.044	6hivCH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
12	PDB:3ez2B	0.060	0.084	4.825	394	0.017	0.025	3ez2B.pdb.gz	Structural basis for ADP-mediated transcriptional regulation by P1 and P7 ParA.
13	PDB:7r5jV0	0.077	0.159	4.825	273	0.071	0.154	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
14	PDB:3ib7A	0.031	0.059	5.181	295	0.008	0.017	3ib7A.pdb.gz	A mycobacterial cyclic AMP phosphodiesterase that moonlights as a modifier of cell wall permeability
15	PDB:6hivAg	0.059	0.110	5.181	259	0.025	0.058	6hivAg.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
16	PDB:6tdaL	0.061	0.061	6.891	596	0.034	0.034	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
17	PDB:7vhpG	0.057	0.108	6.891	299	0.025	0.050	7vhpG.pdb.gz
18	PDB:7emfN	0.073	0.047	9.165	1017	0.040	0.024	7emfN.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GVM0	0.0	1207	812	1.000	0.730	A0A1B0GVM0_HUMAN Brain enriched guanylate kinase associated OS=Homo sapiens OX=9606 GN=BEGAIN PE=1 SV=1
2	O88881	0.0	989	611	0.877	0.851	BEGIN_RAT Brain-enriched guanylate kinase-associated protein OS=Rattus norvegicus OX=10116 GN=Begain PE=1 SV=1
3	Q68EF6	0.0	964	600	0.865	0.855	BEGIN_MOUSE Brain-enriched guanylate kinase-associated protein OS=Mus musculus OX=10090 GN=Begain PE=1 SV=2
4	Q9BUH8	0.0	1205	593	1.000	1.000	BEGIN_HUMAN Brain-enriched guanylate kinase-associated protein OS=Homo sapiens OX=9606 GN=BEGAIN PE=1 SV=1
5	Q5JTD0	2.55e-42	162	557	0.159	0.169	TJAP1_HUMAN Tight junction-associated protein 1 OS=Homo sapiens OX=9606 GN=TJAP1 PE=1 SV=1
6	Q9DCD5	1.33e-39	154	549	0.157	0.169	TJAP1_MOUSE Tight junction-associated protein 1 OS=Mus musculus OX=10090 GN=Tjap1 PE=1 SV=2
7	P25386	0.15	37.7	1790	0.047	0.016	USO1_YEAST Intracellular protein transport protein USO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=USO1 PE=1 SV=2
8	Q3LUD4	0.15	37.7	670	0.035	0.031	LZTS2_RAT Leucine zipper putative tumor suppressor 2 OS=Rattus norvegicus OX=10116 GN=Lzts2 PE=1 SV=2
9	Q91YU6	0.20	37.0	671	0.035	0.031	LZTS2_MOUSE Leucine zipper putative tumor suppressor 2 OS=Mus musculus OX=10090 GN=Lzts2 PE=1 SV=3
10	Q5SX40	0.23	37.0	1942	0.042	0.013	MYH1_MOUSE Myosin-1 OS=Mus musculus OX=10090 GN=Myh1 PE=1 SV=1
11	A0A0G2K484	0.31	36.6	1939	0.042	0.013	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
12	B6IDE1	0.31	36.6	1939	0.066	0.020	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
13	F1LMU0	0.31	36.6	1939	0.042	0.013	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
14	Q29RW1	0.31	36.6	1939	0.042	0.013	MYH4_RAT Myosin-4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
15	Q5SX39	0.31	36.6	1939	0.042	0.013	MYH4_MOUSE Myosin-4 OS=Mus musculus OX=10090 GN=Myh4 PE=1 SV=1
16	Q6YJK1	0.35	36.6	1936	0.054	0.017	Q6YJK1_DANRE Atrial myosin heavy chain OS=Danio rerio OX=7955 GN=amhc PE=1 SV=1
17	O16844	0.39	36.2	1201	0.078	0.038	COS_DROME Kinesin-like protein costa OS=Drosophila melanogaster OX=7227 GN=cos PE=1 SV=2
18	Q9SCS9	0.39	35.0	189	0.056	0.175	HR1_ARATH RPW8-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=HR1 PE=2 SV=1
19	P48616	0.44	35.8	466	0.052	0.067	VIME_BOVIN Vimentin OS=Bos taurus OX=9913 GN=VIM PE=1 SV=3
20	Q96PC5	0.44	36.2	1412	0.057	0.024	MIA2_HUMAN Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10498 IFT57	3.2e+02	11.7	Intra-flagellar transport protein 57
2	PF15294 Leu_zip	2.1e+02	12.8	Leucine zipper
3	PF01496 V_ATPase_I	9.8e+02	9.0	V-type ATPase 116kDa subunit family
4	PF10779 XhlA	5.3e+02	12.2	Haemolysin XhlA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000411124

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382428	0.974	Disks large homolog 4
2	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
3	9606.ENSP00000365272	0.918	Disks large homolog 2
4	9606.ENSP00000334148	0.870	WD repeat-containing protein 25
5	9606.ENSP00000428182	0.824	MAGUK p55 subfamily member 2
6	9606.ENSP00000340292	0.723	Protein delta homolog 1
7	9606.ENSP00000359384	0.718	Oocyte-expressed protein homolog
8	9606.ENSP00000363480	0.707	Disks large homolog 3
9	9606.ENSP00000360608	0.674	Glutamate receptor ionotropic, NMDA 1
10	9606.ENSP00000435342	0.672	Retrotransposon-like protein 1
11	9606.ENSP00000379818	0.671	Glutamate receptor ionotropic, NMDA 2A
12	9606.ENSP00000293190	0.660	Glutamate receptor ionotropic, NMDA 2C
13	9606.ENSP00000427336	0.636	Thyroxine 5-deiodinase
14	9606.ENSP00000477455	0.624	Glutamate receptor ionotropic, NMDA 2B
15	9606.ENSP00000263269	0.615	Glutamate receptor ionotropic, NMDA 2D
16	9606.ENSP00000398930	0.615	Epsilon-sarcoglycan
17	9606.ENSP00000403636	0.600	Ras/Rap GTPase-activating protein SynGAP
18	9606.ENSP00000319231	0.555	Pleckstrin homology-like domain family A member 2
19	9606.ENSP00000347152	0.520	Attractin-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0023052	0.988	signaling
GO:0007154	0.988	cell communication
GO:0050794	0.988	regulation of cellular process
GO:0050896	0.913	response to stimulus
GO:0051716	0.898	cellular response to stimulus
GO:0007165	0.781	signal transduction
GO:0032501	0.764	multicellular organismal process
GO:0007268	0.663	chemical synaptic transmission
GO:0007166	0.614	cell surface receptor signaling pathway
GO:0050877	0.598	nervous system process
GO:0010646	0.586	regulation of cell communication
GO:0023051	0.577	regulation of signaling
GO:0048583	0.495	regulation of response to stimulus
GO:1905114	0.475	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0099565	0.474	chemical synaptic transmission, postsynaptic
GO:0065009	0.469	regulation of molecular function
GO:0009966	0.448	regulation of signal transduction
GO:0065008	0.410	regulation of biological quality
GO:0051239	0.343	regulation of multicellular organismal process
GO:0042391	0.335	regulation of membrane potential
GO:0010469	0.335	regulation of signaling receptor activity
GO:0031644	0.333	regulation of nervous system process
GO:0099601	0.332	regulation of neurotransmitter receptor activity
GO:0099177	0.330	regulation of trans-synaptic signaling
GO:0050804	0.323	modulation of chemical synaptic transmission

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	0.997	cell junction
GO:0045202	0.992	synapse
GO:0005737	0.992	cytoplasm
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0005829	0.976	cytosol
GO:0098978	0.972	glutamatergic synapse
GO:0005886	0.915	plasma membrane
GO:0005634	0.897	nucleus
GO:0012505	0.722	endomembrane system
GO:0120025	0.679	plasma membrane bounded cell projection
GO:0098794	0.565	postsynapse
GO:0043005	0.450	neuron projection
GO:0070013	0.407	intracellular organelle lumen
GO:0036477	0.371	somatodendritic compartment
GO:0030425	0.355	dendrite
GO:0043025	0.315	neuronal cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]