StarFunc result for job id Q9BUI4

User Input

>input (534 residues)
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQH
NLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSA
VVKKVADRLTETMEDGKTMDYAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTL
VINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLD
RFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVG
YNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATLESVVQERFGS
RCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRT
FYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQATGAE
EAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMKRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BUI4	1.000	1.000	8.133E-79	534	1.000	1.000	Q9BUI4.pdb.gz	RPC3_HUMAN DNA-directed RNA polymerase III subunit RPC3 OS=Homo sapiens OX=9606 GN=POLR3C PE=1 SV=1
2	PDB:7a6hO	0.924	0.962	9.186E-63	512	0.959	1.000	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
3	PDB:7d58O	0.857	0.931	2.082E-56	490	0.916	0.998	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
4	PDB:5afqB	0.793	0.949	2.936E-51	444	0.828	0.995	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.
5	PDB:7dn3O	0.785	0.943	1.519E-47	443	0.824	0.993	7dn3O.pdb.gz	Structure of human RNA polymerase III elongation complex.
6	PDB:2xv4S	0.682	0.899	1.718E-42	399	0.742	0.992	2xv4S.pdb.gz
7	AFDB:Q9C106	0.741	0.673	4.254E-26	591	0.219	0.198	Q9C106.pdb.gz	RPC3_SCHPO DNA-directed RNA polymerase III subunit rpc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc82 PE=1 SV=1
8	AFDB:P32349	0.711	0.586	1.215E-20	654	0.176	0.144	P32349.pdb.gz	RPC3_YEAST DNA-directed RNA polymerase III subunit RPC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPC82 PE=1 SV=2
9	PDB:7z1mO	0.710	0.668	2.757E-20	570	0.174	0.163	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
10	AFDB:Q587G4	0.694	0.660	9.340E-17	563	0.152	0.144	Q587G4.pdb.gz	Q587G4_TRYB2 DNA-directed RNA polymerase III subunit RPC3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=10C8.295 PE=3 SV=1
11	PDB:5fj9O	0.657	0.664	4.541E-13	528	0.176	0.178	5fj9O.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
12	AFDB:Q9P3W1	0.182	0.222	6.462E-3	434	0.026	0.032	Q9P3W1.pdb.gz	T2EA_SCHPO Transcription initiation factor IIE subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tfa1 PE=1 SV=3
13	PDB:7o4iW	0.193	0.323	7.247E-3	312	0.028	0.048	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	AFDB:G5EG49	0.186	0.227	9.195E-3	433	0.034	0.042	G5EG49.pdb.gz	G5EG49_CAEEL HTH TFE/IIEalpha-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gtf-2e1 PE=1 SV=1
15	AFDB:O96880	0.183	0.226	1.308E-2	429	0.026	0.033	O96880.pdb.gz	O96880_DROME GH11150p OS=Drosophila melanogaster OX=7227 GN=TfIIEalpha PE=1 SV=1
16	AFDB:O15479	0.111	0.167	1.631E-2	319	0.054	0.091	O15479.pdb.gz	MAGB2_HUMAN Melanoma-associated antigen B2 OS=Homo sapiens OX=9606 GN=MAGEB2 PE=1 SV=3
17	AFDB:P71672	0.135	0.406	1.781E-2	160	0.049	0.163	P71672.pdb.gz	P71672_MYCTU Probable transcriptional regulatory protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1404 PE=1 SV=1
18	AFDB:P36100	0.194	0.214	2.033E-2	482	0.028	0.031	P36100.pdb.gz	T2EA_YEAST Transcription initiation factor IIE subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFA1 PE=1 SV=1
19	PDB:2nyxB	0.132	0.437	3.103E-2	147	0.039	0.143	2nyxB.pdb.gz
20	PDB:6o9lQ	0.181	0.223	4.823E-2	430	0.021	0.026	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PHH9	0.0	850	411	0.762	0.990	E9PHH9_HUMAN DNA-directed RNA polymerase III subunit RPC3 OS=Homo sapiens OX=9606 GN=POLR3C PE=1 SV=1
2	Q9BT08	0.0	849	411	0.760	0.988	Q9BT08_HUMAN DNA-directed RNA polymerase III subunit RPC3 OS=Homo sapiens OX=9606 GN=POLR3C PE=1 SV=1
3	Q9BUI4	0.0	1110	534	1.000	1.000	RPC3_HUMAN DNA-directed RNA polymerase III subunit RPC3 OS=Homo sapiens OX=9606 GN=POLR3C PE=1 SV=1
4	Q9C106	1.09e-29	125	591	0.236	0.213	RPC3_SCHPO DNA-directed RNA polymerase III subunit rpc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc82 PE=1 SV=1
5	P32349	9.86e-10	63.5	654	0.069	0.057	RPC3_YEAST DNA-directed RNA polymerase III subunit RPC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPC82 PE=1 SV=2
6	Q587G4	1.25e-06	53.5	563	0.073	0.069	Q587G4_TRYB2 DNA-directed RNA polymerase III subunit RPC3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=10C8.295 PE=3 SV=1
7	Q9LZ03	0.31	36.2	427	0.062	0.077	TOP6A_ARATH DNA topoisomerase 6 subunit A OS=Arabidopsis thaliana OX=3702 GN=TOP6A PE=1 SV=1
8	P14742	1.6	33.9	717	0.051	0.038	GFA1_YEAST Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GFA1 PE=1 SV=4
9	Q55CR5	3.6	33.1	2044	0.051	0.013	Q55CR5_DICDI Regulator of chromosome condensation domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269934 PE=4 SV=1
10	F6Q6H0	4.3	32.7	580	0.058	0.053	F6Q6H0_HUMAN RB binding protein 8, endonuclease (Fragment) OS=Homo sapiens OX=9606 GN=RBBP8 PE=1 SV=1
11	Q9VK45	4.7	32.7	2470	0.066	0.014	TOR_DROME Serine/threonine-protein kinase mTor OS=Drosophila melanogaster OX=7227 GN=mTor PE=1 SV=1
12	Q99708	5.3	32.3	897	0.052	0.031	CTIP_HUMAN DNA endonuclease RBBP8 OS=Homo sapiens OX=9606 GN=RBBP8 PE=1 SV=2
13	I6L8A6	5.5	32.3	902	0.052	0.031	I6L8A6_HUMAN DNA endonuclease RBBP8 OS=Homo sapiens OX=9606 GN=RBBP8 PE=1 SV=1
14	Q9VTE0	5.9	31.2	159	0.024	0.082	BL1S2_DROME Biogenesis of lysosome-related organelles complex 1 subunit 2 OS=Drosophila melanogaster OX=7227 GN=Blos2 PE=1 SV=2
15	P70259	6.3	32.0	405	0.045	0.059	GP143_MOUSE G-protein coupled receptor 143 OS=Mus musculus OX=10090 GN=Gpr143 PE=2 SV=1
16	Q9JI85	8.6	31.6	420	0.028	0.036	NUCB2_RAT Nucleobindin-2 OS=Rattus norvegicus OX=10116 GN=Nucb2 PE=1 SV=1
17	P81117	9.4	31.2	420	0.028	0.036	NUCB2_MOUSE Nucleobindin-2 OS=Mus musculus OX=10090 GN=Nucb2 PE=1 SV=2
18	F4K1U5	9.8	30.8	199	0.036	0.095	F4K1U5_ARATH Trafficking protein particle complex subunit OS=Arabidopsis thaliana OX=3702 GN=TRAPPC3 PE=1 SV=1
19	Q5A663	9.9	31.2	336	0.028	0.045	OMA1_CANAL Mitochondrial metalloendopeptidase OMA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OMA1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08221 HTH_9	5.2e-21	85.8	RNA polymerase III subunit RPC82 helix-turn-helix domain
2	PF05645 RNA_pol_Rpc82	3e-40	150.2	RNA polymerase III subunit RPC82
3	PF02002 TFIIE_alpha	58	15.0	TFIIE alpha subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334564

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228347	0.999	DNA-directed RNA polymerase III subunit RPC2
2	9606.ENSP00000299853	0.999	DNA-directed RNA polymerase III subunit RPC5
3	9606.ENSP00000347345	0.999	DNA-directed RNA polymerase III subunit RPC8
4	9606.ENSP00000361446	0.999	DNA-directed RNA polymerase III subunit RPC1
5	9606.ENSP00000361465	0.999	DNA-directed RNA polymerases I and III subunit RPAC1
6	9606.ENSP00000366828	0.999	DNA-directed RNA polymerase III subunit RPC6
7	9606.ENSP00000380904	0.999	DNA-directed RNA polymerase III subunit RPC4
8	9606.ENSP00000382058	0.998	DNA-directed RNA polymerase III subunit RPC7
9	9606.ENSP00000415536	0.998	DNA-directed RNA polymerases I, II, and III subunit RPABC3
10	9606.ENSP00000478303	0.998	DNA-directed RNA polymerases I, II, and III subunit RPABC1
11	9606.ENSP00000378736	0.995	DNA-directed RNA polymerase III subunit RPC9
12	9606.ENSP00000302478	0.994	DNA-directed RNA polymerases I and III subunit RPAC2
13	9606.ENSP00000358320	0.989	DNA-directed RNA polymerase III subunit RPC7-like
14	9606.ENSP00000324124	0.988	DNA-directed RNA polymerases I, II, and III subunit RPABC5
15	9606.ENSP00000293860	0.987	DNA-directed RNA polymerase III subunit RPC10
16	9606.ENSP00000403852	0.984	DNA-directed RNA polymerases I, II, and III subunit RPABC2
17	9606.ENSP00000263857	0.964	DNA-directed RNA polymerase I subunit RPA1
18	9606.ENSP00000444136	0.964	DNA-directed RNA polymerase I subunit RPA2
19	9606.ENSP00000351575	0.962	Transcription factor TFIIIB component B'' homolog
20	9606.ENSP00000342889	0.955	DNA-directed RNA polymerases I, II, and III subunit RPABC4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003899	1.000	DNA-directed 5'-3' RNA polymerase activity
GO:0003697	0.998	single-stranded DNA binding
GO:0003723	0.330	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.977	regulation of biological process
GO:0010468	0.966	regulation of gene expression
GO:0010604	0.963	positive regulation of macromolecule metabolic process
GO:0010556	0.962	regulation of macromolecule biosynthetic process
GO:0031326	0.962	regulation of cellular biosynthetic process
GO:0051252	0.962	regulation of RNA metabolic process
GO:2001141	0.951	regulation of RNA biosynthetic process
GO:0006355	0.932	regulation of DNA-templated transcription
GO:0032648	0.930	regulation of interferon-beta production
GO:0032481	0.930	positive regulation of type I interferon production
GO:0006359	0.885	regulation of transcription by RNA polymerase III
GO:0050776	0.880	regulation of immune response
GO:0031347	0.874	regulation of defense response
GO:0002831	0.872	regulation of response to biotic stimulus
GO:0032101	0.834	regulation of response to external stimulus
GO:0032728	0.799	positive regulation of interferon-beta production
GO:0048584	0.788	positive regulation of response to stimulus
GO:0002833	0.783	positive regulation of response to biotic stimulus
GO:0045089	0.770	positive regulation of innate immune response
GO:0009987	0.720	cellular process
GO:0071704	0.656	organic substance metabolic process
GO:0044238	0.635	primary metabolic process
GO:0044237	0.602	cellular metabolic process
GO:0006807	0.591	nitrogen compound metabolic process
GO:0043170	0.578	macromolecule metabolic process
GO:0090304	0.572	nucleic acid metabolic process
GO:0010467	0.466	gene expression
GO:0016070	0.454	RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.995	protein-containing complex
GO:1902494	0.992	catalytic complex
GO:0140513	0.991	nuclear protein-containing complex
GO:0005829	0.987	cytosol
GO:1990234	0.981	transferase complex
GO:0061695	0.962	transferase complex, transferring phosphorus-containing groups
GO:0140535	0.950	intracellular protein-containing complex
GO:0055029	0.939	nuclear DNA-directed RNA polymerase complex
GO:0043232	0.881	intracellular non-membrane-bounded organelle
GO:0005666	0.740	RNA polymerase III complex
GO:0005730	0.444	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.6	1.000	DNA-directed RNA polymerase.

[back to server]