StarFunc result for job id Q9BUJ0

User Input

>input (271 residues)
MVGALCGCWFRLGGARPLIPLGPTVVQTSMSRSQVALLGLSLLLMLLLYVGLPGPPEQTS
CLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQLGTLQLLS
QRGYRAVALDLPGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALPF
LMRGHHQLHGFVPIAPTSTQNYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHS
VVKLRNAGHACYLHKPQDFHLVLLAFLDHLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q922Q6	0.863	0.944	1.762E-44	247	0.742	0.814	Q922Q6.pdb.gz	ABHEA_MOUSE Protein ABHD14A OS=Mus musculus OX=10090 GN=Abhd14a PE=1 SV=2
2	AFDB:Q96IU4	0.686	0.878	4.863E-23	210	0.336	0.433	Q96IU4.pdb.gz	ABHEB_HUMAN Putative protein-lysine deacylase ABHD14B OS=Homo sapiens OX=9606 GN=ABHD14B PE=1 SV=1
3	PDB:1imjA	0.673	0.869	7.552E-22	208	0.336	0.438	1imjA.pdb.gz
4	AFDB:Q8VYJ0	0.626	0.457	2.129E-12	382	0.185	0.131	Q8VYJ0.pdb.gz	Q8VYJ0_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL2 PE=1 SV=1
5	AFDB:Q94AM5	0.628	0.383	5.300E-12	463	0.203	0.119	Q94AM5.pdb.gz	Q94AM5_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL4 PE=1 SV=1
6	AFDB:P77044	0.578	0.547	7.182E-12	288	0.188	0.177	P77044.pdb.gz	MHPC_ECOLI 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mhpC PE=1 SV=4
7	PDB:1u2eA	0.572	0.545	1.594E-11	286	0.188	0.178	1u2eA.pdb.gz
8	AFDB:Q9BV23	0.616	0.503	1.788E-11	337	0.177	0.142	Q9BV23.pdb.gz	ABHD6_HUMAN Monoacylglycerol lipase ABHD6 OS=Homo sapiens OX=9606 GN=ABHD6 PE=1 SV=1
9	AFDB:Q1QEU6	0.601	0.522	3.941E-11	315	0.185	0.159	Q1QEU6.pdb.gz	Q1QEU6_PSYCK Alpha/beta hydrolase fold protein OS=Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5) OX=335284 GN=Pcryo_0023 PE=1 SV=1
10	AFDB:F4HYC8	0.547	0.479	5.341E-11	315	0.140	0.121	F4HYC8.pdb.gz	F4HYC8_ARATH Carboxymethylenebutenolidase homolog OS=Arabidopsis thaliana OX=3702 GN=At1g35420 PE=1 SV=1
11	AFDB:Q07646	0.615	0.505	7.692E-11	335	0.225	0.182	Q07646.pdb.gz	MEST_MOUSE Mesoderm-specific transcript protein OS=Mus musculus OX=10090 GN=Mest PE=2 SV=1
12	AFDB:P9WNH3	0.595	0.480	8.687E-11	341	0.159	0.126	P9WNH3.pdb.gz	Y2715_MYCTU Uncharacterized protein Rv2715 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2715 PE=1 SV=1
13	PDB:2ocgA	0.614	0.652	5.099E-10	254	0.155	0.165	2ocgA.pdb.gz	Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
14	PDB:4g8bA	0.562	0.551	5.419E-10	277	0.151	0.148	4g8bA.pdb.gz	High-resolution structures of AidH complexes provide insights into a novel catalytic mechanism for N-acyl homoserine lactonase
15	PDB:5jzsB	0.583	0.559	1.619E-9	284	0.170	0.162	5jzsB.pdb.gz	Investigation of the mycobacterial enzyme HsaD as a potential novel target for anti-tubercular agents using a fragment-based drug design approach.
16	PDB:3e3aB	0.578	0.570	2.478E-9	275	0.140	0.138	3e3aB.pdb.gz
17	PDB:5aljA	0.596	0.322	2.973E-9	523	0.185	0.096	5aljA.pdb.gz	Successful Generation of Structural Information for Fragment-Based Drug Discovery.
18	PDB:6eicB	0.643	0.626	3.792E-9	279	0.155	0.151	6eicB.pdb.gz
19	PDB:3p2mA	0.546	0.528	4.836E-9	281	0.181	0.174	3p2mA.pdb.gz
20	PDB:3kxpA	0.617	0.623	6.168E-9	268	0.162	0.164	3kxpA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q922Q6	7.44e-137	387	247	0.742	0.814	ABHEA_MOUSE Protein ABHD14A OS=Mus musculus OX=10090 GN=Abhd14a PE=1 SV=2
2	F8W9U3	3.94e-53	173	208	0.328	0.428	F8W9U3_HUMAN Abhydrolase domain containing 14B OS=Homo sapiens OX=9606 GN=ABHD14B PE=1 SV=1
3	Q96IU4	9.56e-51	167	210	0.336	0.433	ABHEB_HUMAN Putative protein-lysine deacylase ABHD14B OS=Homo sapiens OX=9606 GN=ABHD14B PE=1 SV=1
4	V9HW87	9.56e-51	167	210	0.336	0.433	V9HW87_HUMAN Abhydrolase domain containing 14B, isoform CRA_a OS=Homo sapiens OX=9606 GN=HEL-S-299 PE=2 SV=1
5	P77044	5.14e-04	43.1	288	0.092	0.087	MHPC_ECOLI 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mhpC PE=1 SV=4
6	Q07646	0.003	40.8	335	0.107	0.087	MEST_MOUSE Mesoderm-specific transcript protein OS=Mus musculus OX=10090 GN=Mest PE=2 SV=1
7	Q5EB52	0.006	40.0	335	0.107	0.087	MEST_HUMAN Mesoderm-specific transcript homolog protein OS=Homo sapiens OX=9606 GN=MEST PE=1 SV=2
8	O14249	0.009	39.7	428	0.070	0.044	CLD1_SCHPO Probable cardiolipin-specific deacylase 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.03c PE=3 SV=1
9	P9WNH3	0.022	38.1	341	0.114	0.091	Y2715_MYCTU Uncharacterized protein Rv2715 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2715 PE=1 SV=1
10	Q8LFX7	0.051	37.4	469	0.122	0.070	BDG1_ARATH Probable lysophospholipase BODYGUARD 1 OS=Arabidopsis thaliana OX=3702 GN=BDG1 PE=2 SV=1
11	P87056	0.10	36.2	364	0.063	0.047	YDJ8_SCHPO Abhydrolase domain-containing protein C57A10.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC57A10.08c PE=3 SV=2
12	O48789	0.12	35.8	320	0.077	0.066	O48789_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g26750 PE=2 SV=1
13	Q12385	0.16	35.8	394	0.081	0.056	ICT1_YEAST 1-acylglycerol-3-phosphate O-acyltransferase ICT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ICT1 PE=3 SV=1
14	Q42566	0.18	35.4	321	0.077	0.065	Q42566_ARATH ATsEH OS=Arabidopsis thaliana OX=3702 GN=SEH PE=1 SV=1
15	A4IJ41	0.22	35.0	466	0.162	0.094	A4IJ41_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g10840 PE=1 SV=1
16	Q9FW03	0.22	35.0	390	0.063	0.044	MES11_ARATH Putative methylesterase 11, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MES11 PE=1 SV=1
17	P71702	0.30	34.7	298	0.066	0.060	P71702_MYCTO AB hydrolase-1 domain-containing protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT0051 PE=1 SV=2
18	P9WNH5	0.37	34.3	291	0.100	0.093	HSAD_MYCTU 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hsaD PE=1 SV=1
19	Q700D5	0.45	34.3	417	0.070	0.046	BDG4_ARATH Probable lysophospholipase BODYGUARD 4 OS=Arabidopsis thaliana OX=3702 GN=BDG4 PE=2 SV=1
20	D2J2T6	0.47	33.9	271	0.077	0.077	D2J2T6_9HYPH Alpha/beta hydrolase fold protein OS=Ochrobactrum sp. T63 OX=680275 GN=aidH PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	1.1e-09	49.9	alpha/beta hydrolase fold
2	PF20408 Abhydrolase_11	64	14.7	Alpha/beta hydrolase domain
3	PF12697 Abhydrolase_6	3.2e-06	39.4	Alpha/beta hydrolase family
4	PF01738 DLH	4.9e+02	11.7	Dienelactone hydrolase family
5	PF03959 FSH1	1.6e+02	13.4	Serine hydrolase (FSH1)
6	PF12146 Hydrolase_4	1.8e-05	35.7	Serine aminopeptidase, S33

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273596

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268129	0.813	Monoacylglycerol lipase ABHD2
2	9606.ENSP00000390849	0.712	1-acylglycerol-3-phosphate O-acyltransferase ABHD5
3	9606.ENSP00000336693	0.693	Belongs to the serine esterase family
4	9606.ENSP00000358932	0.673	Protein ABHD16B
5	9606.ENSP00000381937	0.661	Protein ABHD18
6	9606.ENSP00000247706	0.634	Protein ABHD8
7	9606.ENSP00000222800	0.591	Protein ABHD11
8	9606.ENSP00000289119	0.586	Phospholipase ABHD3
9	9606.ENSP00000365063	0.582	Protein ABHD13
10	9606.ENSP00000379282	0.560	Phosphatidylserine (PS) lipase that mediates the hydrolysis of phosphatidylserine to generate lysophosphatidylserine (LPS) (By similarity). LPS constitutes a class of signaling lipids that regulates immunological and neurological processes (By similarity). Has no activity towards diacylglycerol, triacylglycerol or lysophosphatidylserine lipase . Also has monoacylglycerol lipase activity, with preference for 1-(9Z,12Z- octadecadienoyl)-glycerol (1-LG) and 2-glyceryl-15-deoxy-Delta(12,14)- prostaglandin J2 (15d-PGJ(2)-G) .
11	9606.ENSP00000273359	0.550	Mycophenolic acid acyl-glucuronide esterase, mitochondrial
12	9606.ENSP00000326491	0.550	Protein ABHD1
13	9606.ENSP00000414558	0.548	Protein ABHD4
14	9606.ENSP00000302657	0.526	Protein ABHD15
15	9606.ENSP00000410768	0.517	Protein FAM135A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016787	0.999	hydrolase activity
GO:0005515	0.999	protein binding
GO:0052689	0.658	carboxylic ester hydrolase activity
GO:0016298	0.553	lipase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0044237	0.980	cellular metabolic process
GO:0044238	0.975	primary metabolic process
GO:0006807	0.718	nitrogen compound metabolic process
GO:0065007	0.705	biological regulation
GO:0050789	0.685	regulation of biological process
GO:1901564	0.654	organonitrogen compound metabolic process
GO:0050794	0.597	regulation of cellular process
GO:0044281	0.547	small molecule metabolic process
GO:0043436	0.508	oxoacid metabolic process
GO:0006796	0.448	phosphate-containing compound metabolic process
GO:0019637	0.364	organophosphate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043227	0.959	membrane-bounded organelle
GO:0043229	0.930	intracellular organelle
GO:0043231	0.905	intracellular membrane-bounded organelle
GO:0016020	0.890	membrane
GO:0043233	0.880	organelle lumen
GO:0070013	0.871	intracellular organelle lumen
GO:0005634	0.735	nucleus
GO:0031981	0.725	nuclear lumen
GO:0005654	0.706	nucleoplasm
GO:0005829	0.481	cytosol
GO:0071944	0.425	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.999	Hydrolases.
EC:3.1.1.-	0.658	Carboxylic ester hydrolases.

[back to server]