StarFunc result for job id Q9BUL5

User Input

>input (403 residues)
MLEAMAEPSPEDPPPTLKPETQPPEKRRRTIEDFNKFCSFVLAYAGYIPPSKEESDWPAS
GSSSPLRGESAADSDGWDSAPSDLRTIQTFVKKAKSSKRRAAQAGPTQPGPPRSTFSRLQ
APDSATLLEKMKLKDSLFDLDGPKVASPLSPTSLTHTSRPPAALTPVPLSQGDLSHPPRK
KDRKNRKLGPGAGAGFGVLRRPRPTPGDGEKRSRIKKSKKRKLKKAERGDRLPPPGPPQA
PPSDTDSEEEEEEEEEEEEEEMATVVGGEAPVPVLPTPPEAPRPPATVHPEGVPPADSES
KEVGSTETSQDGDASSSEGEMRVMDEDIMVESGDDSWDLITCYCRKPFAGRPMIECSLCG
TWIHLSCAKIKKTNVPDFFYCQKCKELRPEARRLGGPPKSGEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BUL5	0.999	0.999	1.607E-61	403	1.000	1.000	Q9BUL5.pdb.gz	PHF23_HUMAN PHD finger protein 23 OS=Homo sapiens OX=9606 GN=PHF23 PE=1 SV=1
2	AFDB:Q9D0P5	0.125	0.121	6.529E-5	417	0.161	0.156	Q9D0P5.pdb.gz	PYGO1_MOUSE Pygopus homolog 1 OS=Mus musculus OX=10090 GN=Pygo1 PE=1 SV=1
3	PDB:5z8lA	0.107	0.206	4.419E-3	204	0.032	0.064	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
4	AFDB:Q57XS3	0.081	0.055	6.068E-3	651	0.189	0.117	Q57XS3.pdb.gz	Q57XS3_TRYB2 Zinc-finger of a C2HC-type OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.370 PE=4 SV=1
5	AFDB:Q9BRQ0	0.129	0.128	1.462E-2	406	0.176	0.175	Q9BRQ0.pdb.gz	PYGO2_HUMAN Pygopus homolog 2 OS=Homo sapiens OX=9606 GN=PYGO2 PE=1 SV=2
6	AFDB:Q64127	0.119	0.055	2.512E-2	1051	0.166	0.064	Q64127.pdb.gz	TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus OX=10090 GN=Trim24 PE=1 SV=1
7	AFDB:Q6ZPK0	0.126	0.081	5.656E-2	688	0.194	0.113	Q6ZPK0.pdb.gz	PF21A_MOUSE PHD finger protein 21A OS=Mus musculus OX=10090 GN=Phf21a PE=1 SV=3
8	AFDB:Q24459	0.103	0.043	1.274E-1	1043	0.164	0.063	Q24459.pdb.gz	PCL_DROME Polycomb protein Pcl OS=Drosophila melanogaster OX=7227 GN=Pcl PE=1 SV=2
9	AFDB:Q8BLG0	0.129	0.056	1.274E-1	1010	0.159	0.063	Q8BLG0.pdb.gz	PHF20_MOUSE PHD finger protein 20 OS=Mus musculus OX=10090 GN=Phf20 PE=1 SV=2
10	AFDB:A0A024R784	0.105	0.046	1.669E-1	1016	0.151	0.060	A0A024R784.pdb.gz
11	AFDB:O35274	0.079	0.047	2.341E-1	817	0.179	0.088	O35274.pdb.gz	NEB2_RAT Neurabin-2 OS=Rattus norvegicus OX=10116 GN=Ppp1r9b PE=1 SV=1
12	PDB:6ydhA	0.067	0.247	8.644E-1	62	0.030	0.194	6ydhA.pdb.gz
13	PDB:3j7a3	0.058	0.240	2.083	95	0.037	0.158	3j7a3.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
14	PDB:4kfzB	0.086	0.198	3.828	148	0.022	0.061	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
15	PDB:6ip53C	0.068	0.214	4.096	107	0.037	0.140	6ip53C.pdb.gz	HCV IRES Captures an Actively Translating 80S Ribosome.
16	PDB:4wa6D	0.063	0.062	4.690	415	0.020	0.019	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
17	PDB:7a1gz	0.067	0.163	6.577	120	0.055	0.183	7a1gz.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
18	PDB:7uhyC	0.062	0.044	8.057	578	0.017	0.012	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:2aqcA	0.046	0.211	8.620	63	0.025	0.159	2aqcA.pdb.gz	The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	I3L1N0	0.0	545	273	0.677	1.000	I3L1N0_HUMAN PHD finger protein 23 OS=Homo sapiens OX=9606 GN=PHF23 PE=1 SV=1
2	Q9BUL5	0.0	801	403	1.000	1.000	PHF23_HUMAN PHD finger protein 23 OS=Homo sapiens OX=9606 GN=PHF23 PE=1 SV=1
3	I3L410	7.90e-136	388	201	0.499	1.000	I3L410_HUMAN PHD finger protein 23 (Fragment) OS=Homo sapiens OX=9606 GN=PHF23 PE=1 SV=1
4	Q86YI8	2.18e-31	123	300	0.161	0.217	PHF13_HUMAN PHD finger protein 13 OS=Homo sapiens OX=9606 GN=PHF13 PE=1 SV=2
5	Q9UT79	3.37e-05	48.5	1588	0.062	0.016	MSC1_SCHPO Multicopy suppressor of chk1 protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msc1 PE=3 SV=1
6	Q3UG20	4.08e-05	48.5	1868	0.042	0.009	KMT2E_MOUSE Inactive histone-lysine N-methyltransferase 2E OS=Mus musculus OX=10090 GN=Kmt2e PE=1 SV=2
7	Q8IZD2	4.48e-05	48.1	1858	0.042	0.009	KMT2E_HUMAN Inactive histone-lysine N-methyltransferase 2E OS=Homo sapiens OX=9606 GN=KMT2E PE=1 SV=1
8	Q6ZMT4	7.42e-05	47.4	941	0.045	0.019	KDM7A_HUMAN Lysine-specific demethylase 7A OS=Homo sapiens OX=9606 GN=KDM7A PE=1 SV=2
9	Q3UWM4	1.04e-04	47.0	940	0.045	0.019	KDM7A_MOUSE Lysine-specific demethylase 7A OS=Mus musculus OX=10090 GN=Kdm7a PE=1 SV=2
10	Q9WTU0	1.32e-04	46.6	1096	0.045	0.016	PHF2_MOUSE Lysine-specific demethylase PHF2 OS=Mus musculus OX=10090 GN=Phf2 PE=1 SV=2
11	Q5RHD1	1.36e-04	46.6	875	0.042	0.019	KDM7A_DANRE Lysine-specific demethylase 7A OS=Danio rerio OX=7955 GN=kdm7a PE=2 SV=2
12	Q9UPP1	1.53e-04	46.6	1060	0.047	0.018	PHF8_HUMAN Histone lysine demethylase PHF8 OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=3
13	H0Y3N9	1.82e-04	46.2	1049	0.047	0.018	H0Y3N9_HUMAN PHD finger protein 8 OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=2
14	O75151	1.82e-04	46.2	1096	0.045	0.016	PHF2_HUMAN Lysine-specific demethylase PHF2 OS=Homo sapiens OX=9606 GN=PHF2 PE=1 SV=4
15	Q9VG78	2.10e-04	46.2	2016	0.067	0.013	Q9VG78_DROME Protein partner of snf, isoform A OS=Drosophila melanogaster OX=7227 GN=pps PE=1 SV=1
16	A0A0B4K6G3	2.12e-04	46.2	2018	0.067	0.013	A0A0B4K6G3_DROME Protein partner of snf, isoform B OS=Drosophila melanogaster OX=7227 GN=pps PE=1 SV=1
17	Q08923	2.35e-04	45.4	506	0.040	0.032	CTI6_YEAST Histone deacetylase complex subunit CTI6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTI6 PE=1 SV=1
18	P0CH95	2.82e-04	45.4	1032	0.045	0.017	PHF8_DANRE Histone lysine demethylase PHF8 OS=Danio rerio OX=7955 GN=phf8 PE=1 SV=1
19	F4I240	3.27e-04	45.4	1208	0.042	0.014	JMJ17_ARATH Lysine-specific demethylase JMJ17 OS=Arabidopsis thaliana OX=3702 GN=JMJ17 PE=1 SV=1
20	Q9HDV4	3.81e-04	45.4	1513	0.065	0.017	LID2_SCHPO Lid2 complex component lid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lid2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	16	16.8	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF00628 PHD	0.00055	31.1	PHD-finger
3	PF13831 PHD_2	0.002	28.9	PHD-finger
4	PF11705 RNA_pol_3_Rpc31	76	14.7	DNA-directed RNA polymerase III subunit Rpc31
5	PF11521 TFIIE-A_C	78	15.0	C-terminal general transcription factor TFIIE alpha
6	PF13771 zf-HC5HC2H	6.1e+02	12.1	PHD-like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322579

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316032	0.843	Nuclear pore complex protein Nup98-Nup96
2	9606.ENSP00000369131	0.768	Paired amphipathic helix protein Sin3b
3	9606.ENSP00000307208	0.756	Nucleosome-remodeling factor subunit BPTF
4	9606.ENSP00000443988	0.719	Sin3 histone deacetylase corepressor complex component SDS3
5	9606.ENSP00000382688	0.716	Lysine-specific demethylase 5A
6	9606.ENSP00000378402	0.687	Paired amphipathic helix protein Sin3a
7	9606.ENSP00000326579	0.651	Cytochrome c-type heme lyase
8	9606.ENSP00000395929	0.629	Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific
9	9606.ENSP00000272369	0.627	Homeobox protein Meis1
10	9606.ENSP00000322937	0.616	E3 ubiquitin-protein ligase LRSAM1
11	9606.ENSP00000313983	0.615	Histone-lysine N-methyltransferase NSD3
12	9606.ENSP00000282030	0.608	SET binding protein 1
13	9606.ENSP00000370109	0.599	PC4 and SFRS1-interacting protein
14	9606.ENSP00000287239	0.592	Histone acetyltransferase KAT6B
15	9606.ENSP00000314348	0.587	Probable ATP-dependent RNA helicase DDX10
16	9606.ENSP00000340454	0.572	Rap1 GTPase-GDP dissociation stimulator 1
17	9606.ENSP00000376322	0.571	Homeobox protein Hox-D13
18	9606.ENSP00000307411	0.568	Protein AF-10
19	9606.ENSP00000342626	0.550	Eyes absent homolog 1
20	9606.ENSP00000398824	0.545	PHD finger protein 21A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.611	chromatin binding
GO:0003824	0.320	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031323	0.990	regulation of cellular metabolic process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0048518	0.986	positive regulation of biological process
GO:0048523	0.986	negative regulation of cellular process
GO:0051173	0.984	positive regulation of nitrogen compound metabolic process
GO:0010604	0.984	positive regulation of macromolecule metabolic process
GO:0031324	0.982	negative regulation of cellular metabolic process
GO:0051128	0.955	regulation of cellular component organization
GO:0033043	0.950	regulation of organelle organization
GO:0031399	0.948	regulation of protein modification process
GO:0009894	0.947	regulation of catabolic process
GO:0051129	0.945	negative regulation of cellular component organization
GO:0010506	0.927	regulation of autophagy
GO:1902115	0.923	regulation of organelle assembly
GO:0051247	0.920	positive regulation of protein metabolic process
GO:0044088	0.917	regulation of vacuole organization
GO:0043244	0.915	regulation of protein-containing complex disassembly
GO:0016241	0.912	regulation of macroautophagy
GO:0043242	0.910	negative regulation of protein-containing complex disassembly
GO:0031401	0.894	positive regulation of protein modification process
GO:1903320	0.854	regulation of protein modification by small protein conjugation or removal
GO:0010639	0.849	negative regulation of organelle organization
GO:0009895	0.840	negative regulation of catabolic process
GO:2000785	0.833	regulation of autophagosome assembly
GO:0010507	0.828	negative regulation of autophagy
GO:0031396	0.824	regulation of protein ubiquitination
GO:0016242	0.824	negative regulation of macroautophagy
GO:1902116	0.813	negative regulation of organelle assembly
GO:0031398	0.778	positive regulation of protein ubiquitination
GO:0009987	0.694	cellular process
GO:0048522	0.655	positive regulation of cellular process
GO:0019219	0.543	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.480	positive regulation of cellular metabolic process
GO:0008152	0.433	metabolic process
GO:0071840	0.377	cellular component organization or biogenesis
GO:0071704	0.376	organic substance metabolic process
GO:0051252	0.355	regulation of RNA metabolic process
GO:0009889	0.354	regulation of biosynthetic process
GO:0016043	0.342	cellular component organization
GO:0010468	0.338	regulation of gene expression
GO:0031326	0.325	regulation of cellular biosynthetic process
GO:0044238	0.322	primary metabolic process
GO:0010556	0.320	regulation of macromolecule biosynthetic process
GO:0006807	0.316	nitrogen compound metabolic process
GO:0043170	0.314	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.540	protein-containing complex
GO:0043232	0.449	intracellular non-membrane-bounded organelle
GO:0005737	0.312	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]