StarFunc result for job id Q9BUP3

User Input

>input (242 residues)
MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEE
AYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAK
AGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPG
EWLVRKFFGSLPDSWASGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSL
KP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BUP3	1.000	1.000	2.026E-50	242	1.000	1.000	Q9BUP3.pdb.gz	HTAI2_HUMAN Oxidoreductase HTATIP2 OS=Homo sapiens OX=9606 GN=HTATIP2 PE=1 SV=2
2	PDB:2bkaA	0.880	0.921	2.281E-43	231	0.950	0.996	2bkaA.pdb.gz	Crystal Structure of Cc3 (Tip30): Implications for its Role as a Tumor Suppressor
3	AFDB:E9PI87	0.750	0.920	9.462E-32	196	0.810	1.000	E9PI87.pdb.gz	E9PI87_HUMAN HIV-1 Tat interactive protein 2 OS=Homo sapiens OX=9606 GN=HTATIP2 PE=1 SV=1
4	AFDB:Q57YG3	0.729	0.614	2.246E-18	290	0.293	0.245	Q57YG3.pdb.gz	Q57YG3_TRYB2 NAD(P)-binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.240 PE=4 SV=1
5	AFDB:P40008	0.791	0.827	2.998E-17	231	0.273	0.286	P40008.pdb.gz	FMP52_YEAST Protein FMP52, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FMP52 PE=1 SV=1
6	AFDB:Q54U38	0.751	0.694	3.372E-17	263	0.302	0.278	Q54U38.pdb.gz	Q54U38_DICDI NAD(P)-binding domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281291 PE=4 SV=1
7	AFDB:Q949S7	0.716	0.650	3.104E-13	269	0.223	0.201	Q949S7.pdb.gz	Q949S7_ARATH NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g15910 PE=1 SV=1
8	AFDB:O74482	0.723	0.640	2.167E-12	276	0.178	0.156	O74482.pdb.gz	YQJ9_SCHPO Uncharacterized protein C1840.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1840.09 PE=3 SV=1
9	AFDB:Q93VH5	0.651	0.560	1.345E-11	287	0.182	0.153	Q93VH5.pdb.gz	Q93VH5_ARATH AT5g10730/MAJ23_90 OS=Arabidopsis thaliana OX=3702 GN=MAJ23.90 PE=1 SV=1
10	AFDB:Q9FVR6	0.681	0.565	1.605E-11	296	0.182	0.149	Q9FVR6.pdb.gz	Y1222_ARATH Uncharacterized protein At1g32220, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g32220 PE=1 SV=1
11	AFDB:Q5BJB8	0.607	0.485	2.424E-11	309	0.169	0.133	Q5BJB8.pdb.gz
12	PDB:7b93P	0.650	0.471	1.395E-10	342	0.174	0.123	7b93P.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
13	PDB:7qskP	0.616	0.447	1.873E-10	342	0.169	0.120	7qskP.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
14	PDB:6g72P	0.620	0.523	1.862E-9	291	0.165	0.137	6g72P.pdb.gz	Cryo-EM structures of complex I from mouse heart mitochondria in two biochemically defined states.
15	PDB:1i3kA	0.662	0.480	2.651E-9	347	0.149	0.104	1i3kA.pdb.gz	Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
16	PDB:7aqrP	0.661	0.492	3.774E-9	332	0.178	0.130	7aqrP.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
17	PDB:2q46A	0.538	0.517	4.003E-9	253	0.194	0.186	2q46A.pdb.gz	Ensemble refinement of protein crystal structures: validation and application.
18	PDB:2ydxA	0.579	0.462	1.300E-8	312	0.178	0.138	2ydxA.pdb.gz	Insight Into S-Adenosylmethionine Biosynthesis from the Crystal Structures of the Human Methionine Adenosyltransferase Catalytic and Regulatory Subunits.
19	PDB:3rftA	0.622	0.571	1.462E-8	266	0.136	0.124	3rftA.pdb.gz
20	PDB:4r1uB	0.596	0.476	1.551E-8	309	0.157	0.123	4r1uB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BUP3	2.80e-180	496	242	1.000	1.000	HTAI2_HUMAN Oxidoreductase HTATIP2 OS=Homo sapiens OX=9606 GN=HTATIP2 PE=1 SV=2
2	E9PI87	4.21e-136	382	196	0.810	1.000	E9PI87_HUMAN HIV-1 Tat interactive protein 2 OS=Homo sapiens OX=9606 GN=HTATIP2 PE=1 SV=1
3	Q54U38	6.40e-27	106	263	0.260	0.240	Q54U38_DICDI NAD(P)-binding domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281291 PE=4 SV=1
4	Q57YG3	2.78e-16	78.2	290	0.211	0.176	Q57YG3_TRYB2 NAD(P)-binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.240 PE=4 SV=1
5	P40008	1.87e-12	66.6	231	0.215	0.225	FMP52_YEAST Protein FMP52, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FMP52 PE=1 SV=1
6	Q04304	1.03e-04	44.7	227	0.198	0.211	YMY0_YEAST UPF0659 protein YMR090W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR090W PE=1 SV=1
7	Q949S7	0.001	41.2	269	0.182	0.164	Q949S7_ARATH NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g15910 PE=1 SV=1
8	Q8H0U5	0.005	40.0	641	0.145	0.055	TIC62_ARATH Protein TIC 62, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC62 PE=1 SV=1
9	Q1H537	0.024	37.7	417	0.207	0.120	DCVR_ARATH Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DVR PE=1 SV=1
10	Q8H124	0.16	35.0	280	0.178	0.154	Y2446_ARATH Uncharacterized protein At2g34460, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g34460 PE=1 SV=1
11	Q8SKU2	0.84	33.1	534	0.128	0.058	TIC62_PEA Protein TIC 62, chloroplastic OS=Pisum sativum OX=3888 GN=TIC62 PE=1 SV=2
12	P30043	0.96	32.3	206	0.091	0.107	BLVRB_HUMAN Flavin reductase (NADPH) OS=Homo sapiens OX=9606 GN=BLVRB PE=1 SV=3
13	V9HWI1	0.96	32.3	206	0.091	0.107	V9HWI1_HUMAN Epididymis secretory protein Li 10 OS=Homo sapiens OX=9606 GN=HEL-S-10 PE=2 SV=1
14	A0A2R8YEP4	1.2	32.3	245	0.091	0.090	A0A2R8YEP4_HUMAN Biliverdin reductase B OS=Homo sapiens OX=9606 GN=BLVRB PE=1 SV=1
15	Q10A77	1.9	32.0	497	0.136	0.066	TIC62_ORYSJ Protein TIC 62, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=TIC62 PE=1 SV=1
16	A0A8I5ZUN1	2.4	31.2	216	0.091	0.102	A0A8I5ZUN1_RAT Biliverdin reductase B OS=Rattus norvegicus OX=10116 GN=Blvrb PE=1 SV=1
17	Q54KL2	2.8	31.6	337	0.120	0.086	Q54KL2_DICDI NAD-dependent epimerase/dehydratase family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0287277 PE=4 SV=1
18	A0A8I6AHQ8	3.4	30.8	247	0.091	0.089	A0A8I6AHQ8_RAT Biliverdin reductase B OS=Rattus norvegicus OX=10116 GN=Blvrb PE=1 SV=1
19	Q0E8W1	3.4	31.2	499	0.066	0.032	Q0E8W1_DROME Fatty acyl-CoA reductase OS=Drosophila melanogaster OX=7227 GN=CG2858 PE=3 SV=1
20	Q9H4M3	3.6	30.8	255	0.087	0.082	FBX44_HUMAN F-box only protein 44 OS=Homo sapiens OX=9606 GN=FBXO44 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	60	14.2	Receptor family ligand binding region
2	PF01113 DapB_N	3.9e+02	12.5	Dihydrodipicolinate reductase, N-terminus
3	PF08967 DUF1884	1.2e+02	14.3	Domain of unknown function (DUF1884)
4	PF01370 Epimerase	68	14.4	NAD dependent epimerase/dehydratase family
5	PF13460 NAD_binding_10	4.6e-09	47.9	NAD(P)H-binding
6	PF03435 Sacchrp_dh_NADP	3	19.5	Saccharopine dehydrogenase NADP binding domain
7	PF01118 Semialdhyde_dh	0.15	23.9	Semialdehyde dehydrogenase, NAD binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392985

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263774	0.793	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
2	9606.ENSP00000339787	0.779	Long-chain-fatty-acid--CoA ligase 4
3	9606.ENSP00000479919	0.773	Endophilin-B1
4	9606.ENSP00000322450	0.743	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
5	9606.ENSP00000354688	0.722	Protein FAM45A
6	9606.ENSP00000392709	0.717	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
7	9606.ENSP00000477213	0.702	Amyloid-beta A4 precursor protein-binding family B member 1
8	9606.ENSP00000340330	0.696	Histone acetyltransferase KAT5
9	9606.ENSP00000330720	0.685	Keratin-associated protein 11-1
10	9606.ENSP00000327268	0.683	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
11	9606.ENSP00000296684	0.681	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
12	9606.ENSP00000442699	0.679	HIV Tat-specific factor 1
13	9606.ENSP00000290231	0.677	Nuclear receptor coactivator 5
14	9606.ENSP00000278025	0.674	Fucose mutarotase
15	9606.ENSP00000362873	0.674	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
16	9606.ENSP00000458770	0.671	Acyl carrier protein, mitochondrial
17	9606.ENSP00000233627	0.668	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
18	9606.ENSP00000040877	0.662	Probable methyltransferase TARBP1
19	9606.ENSP00000315774	0.658	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
20	9606.ENSP00000356972	0.658	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.996	catalytic activity, acting on a protein
GO:0003712	0.996	transcription coregulator activity
GO:0003713	0.994	transcription coactivator activity
GO:0016301	0.990	kinase activity
GO:0004674	0.978	protein serine/threonine kinase activity
GO:0016491	0.928	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0008152	0.982	metabolic process
GO:0044237	0.964	cellular metabolic process
GO:0071704	0.938	organic substance metabolic process
GO:0044238	0.897	primary metabolic process
GO:0065007	0.873	biological regulation
GO:0050789	0.859	regulation of biological process
GO:0050794	0.847	regulation of cellular process
GO:0006807	0.780	nitrogen compound metabolic process
GO:0019222	0.604	regulation of metabolic process
GO:1901564	0.595	organonitrogen compound metabolic process
GO:0051171	0.543	regulation of nitrogen compound metabolic process
GO:0048519	0.537	negative regulation of biological process
GO:0080090	0.537	regulation of primary metabolic process
GO:0031323	0.537	regulation of cellular metabolic process
GO:0060255	0.535	regulation of macromolecule metabolic process
GO:0048518	0.531	positive regulation of biological process
GO:0048523	0.490	negative regulation of cellular process
GO:0019219	0.434	regulation of nucleobase-containing compound metabolic process
GO:0043170	0.416	macromolecule metabolic process
GO:0010468	0.414	regulation of gene expression
GO:0048522	0.392	positive regulation of cellular process
GO:2001141	0.388	regulation of RNA biosynthetic process
GO:0006355	0.346	regulation of DNA-templated transcription
GO:0006796	0.345	phosphate-containing compound metabolic process
GO:0006357	0.336	regulation of transcription by RNA polymerase II
GO:0042981	0.331	regulation of apoptotic process
GO:0009893	0.327	positive regulation of metabolic process
GO:0019538	0.320	protein metabolic process
GO:0045935	0.320	positive regulation of nucleobase-containing compound metabolic process
GO:0043412	0.318	macromolecule modification
GO:0051641	0.315	cellular localization
GO:0010604	0.310	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0016020	0.991	membrane
GO:0005634	0.975	nucleus
GO:0012505	0.962	endomembrane system
GO:0031975	0.955	envelope
GO:0005739	0.899	mitochondrion
GO:0031090	0.898	organelle membrane
GO:0031967	0.878	organelle envelope
GO:0032991	0.513	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.-.-	0.990	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.979	Phosphotransferases with an alcohol group as acceptor.
EC:1.-.-.-	0.928	Oxidoreductases.

[back to server]