StarFunc result for job id Q9BUR4

User Input

>input (548 residues)
MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAG
SAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANG
PELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPD
GSCILTNSADNILRIYNLPPELYHEGEQVEYAEMVPVLRMVEGDTIYDYCWYSLMSSAQP
DTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTV
RVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLYACGSYGRSLGLYAWDDGSPL
ALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFD
LDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATAS
GQRVFPEPTESGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGT
EGGVGELI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BUR4	1.000	1.000	1.078E-98	548	1.000	1.000	Q9BUR4.pdb.gz	TCAB1_HUMAN Telomerase Cajal body protein 1 OS=Homo sapiens OX=9606 GN=WRAP53 PE=1 SV=1
2	PDB:7v9aB	0.647	0.927	1.344E-57	377	0.688	1.000	7v9aB.pdb.gz	Zipper head mechanism of telomere synthesis by human telomerase.
3	PDB:7trcK	0.588	0.970	1.340E-53	330	0.582	0.967	7trcK.pdb.gz	Structure of active human telomerase with telomere shelterin protein TPP1.
4	PDB:2h9lA	0.466	0.763	3.414E-19	321	0.119	0.202	2h9lA.pdb.gz
5	AFDB:P16649	0.431	0.338	1.617E-18	713	0.177	0.136	P16649.pdb.gz	TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUP1 PE=1 SV=2
6	PDB:7vggA	0.485	0.844	7.740E-18	304	0.104	0.188	7vggA.pdb.gz
7	PDB:5mzhB	0.433	0.555	1.603E-17	415	0.117	0.154	5mzhB.pdb.gz
8	PDB:8gqeA	0.507	0.772	2.191E-17	348	0.117	0.184	8gqeA.pdb.gz
9	PDB:3dm0A	0.473	0.389	5.588E-17	675	0.119	0.096	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
10	PDB:7bt6x	0.418	0.464	1.755E-16	488	0.124	0.139	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
11	PDB:7zgrD	0.481	0.653	1.848E-16	395	0.088	0.122	7zgrD.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
12	PDB:4v6wAg	0.486	0.805	2.398E-16	318	0.111	0.192	4v6wAg.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	AFDB:K7EMK7	0.465	0.348	6.750E-16	744	0.126	0.093	K7EMK7.pdb.gz	K7EMK7_HUMAN TLE family member 2, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE2 PE=1 SV=1
14	AFDB:H0YL70	0.484	0.346	8.311E-16	782	0.122	0.086	H0YL70.pdb.gz	H0YL70_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
15	AFDB:F1N9Y3	0.481	0.346	5.999E-15	773	0.120	0.085	F1N9Y3.pdb.gz
16	AFDB:Q64LD2	0.457	0.460	7.781E-15	544	0.162	0.164	Q64LD2.pdb.gz	WDR25_HUMAN WD repeat-containing protein 25 OS=Homo sapiens OX=9606 GN=WDR25 PE=1 SV=3
17	AFDB:Q9C0J8	0.450	0.194	8.971E-14	1336	0.108	0.044	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
18	AFDB:Q5BF66	0.447	0.401	1.226E-13	618	0.166	0.147	Q5BF66.pdb.gz	Q5BF66_EMENI Cell division cycle protein Cdc20, putative (AFU_orthologue AFUA_1G14730) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00814 PE=3 SV=1
19	AFDB:D6W4T8	0.322	0.159	6.728E-12	1266	0.142	0.062	D6W4T8.pdb.gz	D6W4T8_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=pod1 PE=1 SV=1
20	AFDB:F4KB17	0.438	0.295	1.132E-11	839	0.093	0.061	F4KB17.pdb.gz	KTN83_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3 OS=Arabidopsis thaliana OX=3702 GN=KTN80.3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PMG4	0.0	983	515	0.940	1.000	E9PMG4_HUMAN WD repeat containing antisense to TP53 OS=Homo sapiens OX=9606 GN=WRAP53 PE=1 SV=1
2	Q8VC51	0.0	812	532	0.763	0.786	TCAB1_MOUSE Telomerase Cajal body protein 1 OS=Mus musculus OX=10090 GN=Wrap53 PE=1 SV=1
3	Q9BUR4	0.0	1119	548	1.000	1.000	TCAB1_HUMAN Telomerase Cajal body protein 1 OS=Homo sapiens OX=9606 GN=WRAP53 PE=1 SV=1
4	Q6NL34	3.28e-73	244	543	0.274	0.276	TCAB1_DROME Telomerase Cajal body protein 1 homolog OS=Drosophila melanogaster OX=7227 GN=WDR79 PE=1 SV=1
5	O59762	8.21e-28	117	399	0.161	0.221	GNR1_SCHPO Guanine nucleotide-binding protein negative regulator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gnr1 PE=1 SV=1
6	Q15542	4.06e-13	74.7	800	0.131	0.090	TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens OX=9606 GN=TAF5 PE=1 SV=3
7	Q8C092	1.06e-12	73.2	801	0.130	0.089	TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus OX=10090 GN=Taf5 PE=1 SV=1
8	Q7ZUV2	8.00e-12	70.5	694	0.100	0.079	KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio OX=7955 GN=katnb1 PE=2 SV=1
9	Q1LV15	1.29e-10	65.9	415	0.117	0.154	DAW1_DANRE Dynein assembly factor with WD repeat domains 1 OS=Danio rerio OX=7955 GN=daw1 PE=1 SV=2
10	P38129	4.66e-10	64.7	798	0.082	0.056	TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF5 PE=1 SV=1
11	P49846	1.04e-09	63.5	704	0.100	0.078	TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster OX=7227 GN=Taf5 PE=1 SV=1
12	C8V0I4	1.36e-09	63.2	574	0.119	0.113	C8V0I4_EMENI Transcriptional corepressor (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06505 PE=4 SV=1
13	P0CY34	1.46e-09	62.8	512	0.099	0.105	TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TUP1 PE=2 SV=1
14	P46800	3.25e-09	60.8	329	0.093	0.155	GBLP_DICDI Small ribosomal subunit protein RACK1 OS=Dictyostelium discoideum OX=44689 GN=gpbB PE=1 SV=2
15	Q09715	3.27e-09	62.0	614	0.109	0.098	TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tup11 PE=1 SV=1
16	Q9UUG8	3.66e-09	61.6	598	0.111	0.102	TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tup12 PE=1 SV=2
17	Q8H0T9	3.75e-09	62.0	837	0.082	0.054	KTN84_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4 OS=Arabidopsis thaliana OX=3702 GN=KTN80.4 PE=1 SV=3
18	P74598	4.22e-09	60.8	348	0.120	0.190	Y1491_SYNY3 Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1491 PE=4 SV=1
19	P49027	5.30e-09	60.5	334	0.130	0.213	GBLPA_ORYSJ Small ribosomal subunit protein RACK1z OS=Oryza sativa subsp. japonica OX=39947 GN=RACK1A PE=1 SV=1
20	F4KB17	5.93e-09	61.2	839	0.080	0.052	KTN83_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3 OS=Arabidopsis thaliana OX=3702 GN=KTN80.3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.55	21.9	Anaphase-promoting complex subunit 4 WD40 domain
2	PF00400 WD40	1.6e-14	65.2	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324203

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358563	0.999	H/ACA ribonucleoprotein complex subunit 4
2	9606.ENSP00000309572	0.996	Telomerase reverse transcriptase
3	9606.ENSP00000274606	0.989	H/ACA ribonucleoprotein complex subunit 2
4	9606.ENSP00000332198	0.987	H/ACA ribonucleoprotein complex subunit 3
5	9606.ENSP00000226796	0.976	H/ACA ribonucleoprotein complex subunit 1
6	9606.ENSP00000473172	0.969	RuvB-like 2
7	9606.ENSP00000318297	0.964	RuvB-like 1
8	9606.ENSP00000482075	0.925	Prostaglandin E synthase 3
9	9606.ENSP00000240316	0.923	Coilin
10	9606.ENSP00000262715	0.922	Telomerase protein component 1
11	9606.ENSP00000267415	0.921	TERF1-interacting nuclear factor 2
12	9606.ENSP00000328174	0.917	ATP-dependent DNA helicase PIF1
13	9606.ENSP00000274026	0.910	Cyclin-A2
14	9606.ENSP00000266970	0.908	Cyclin-dependent kinase 2
15	9606.ENSP00000281701	0.905	Nuclear valosin-containing protein-like
16	9606.ENSP00000377390	0.904	Serine/threonine-protein phosphatase 6 regulatory subunit 3
17	9606.ENSP00000255465	0.902	Cyclin-A1
18	9606.ENSP00000392147	0.902	Protein phosphatase 6 catalytic subunit
19	9606.ENSP00000382379	0.900	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A
20	9606.ENSP00000353332	0.894	Regulator of telomere elongation helicase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.997	nucleic acid binding
GO:0003723	0.960	RNA binding
GO:0019899	0.926	enzyme binding
GO:0042393	0.824	histone binding
GO:0042802	0.781	identical protein binding
GO:0070034	0.741	telomerase RNA binding
GO:0044877	0.731	protein-containing complex binding
GO:0031625	0.677	ubiquitin protein ligase binding
GO:0051087	0.670	chaperone binding
GO:0003824	0.301	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0071704	0.980	organic substance metabolic process
GO:0071840	0.979	cellular component organization or biogenesis
GO:0019219	0.977	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0044238	0.974	primary metabolic process
GO:0044237	0.972	cellular metabolic process
GO:0016043	0.971	cellular component organization
GO:0051052	0.969	regulation of DNA metabolic process
GO:0006807	0.966	nitrogen compound metabolic process
GO:2000278	0.953	regulation of DNA biosynthetic process
GO:0043170	0.951	macromolecule metabolic process
GO:0051972	0.942	regulation of telomerase activity
GO:0034641	0.936	cellular nitrogen compound metabolic process
GO:0048518	0.929	positive regulation of biological process
GO:0051054	0.921	positive regulation of DNA metabolic process
GO:2000573	0.912	positive regulation of DNA biosynthetic process
GO:0090304	0.897	nucleic acid metabolic process
GO:0043085	0.868	positive regulation of catalytic activity
GO:0000723	0.848	telomere maintenance
GO:0051347	0.807	positive regulation of transferase activity
GO:0071897	0.776	DNA biosynthetic process
GO:0006278	0.745	RNA-templated DNA biosynthetic process
GO:0010833	0.739	telomere maintenance via telomere lengthening
GO:0007004	0.664	telomere maintenance via telomerase
GO:0044085	0.395	cellular component biogenesis
GO:0051179	0.326	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005829	0.999	cytosol
GO:0016604	0.999	nuclear body
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005694	0.972	chromosome
GO:0140513	0.916	nuclear protein-containing complex
GO:1902494	0.901	catalytic complex
GO:1990904	0.883	ribonucleoprotein complex
GO:0090734	0.784	site of DNA damage
GO:0005697	0.581	telomerase holoenzyme complex
GO:0015030	0.531	Cajal body
GO:0035861	0.408	site of double-strand break

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]