StarFunc result for job id Q9BUZ4

User Input

>input (470 residues)
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMK
LSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLL
AQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLK
DSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQELRRELE
ELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QZ59	0.835	0.835	4.065E-97	470	1.000	1.000	A0A024QZ59.pdb.gz
2	AFDB:Q7T1K2	0.747	0.747	6.545E-87	470	0.768	0.768	Q7T1K2.pdb.gz	Q7T1K2_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf4l PE=2 SV=1
3	AFDB:F6SA91	0.733	0.784	1.444E-77	437	0.832	0.895	F6SA91.pdb.gz	F6SA91_HUMAN TNF receptor-associated factor OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1
4	AFDB:A8DYU9	0.581	0.574	9.330E-56	477	0.387	0.382	A8DYU9.pdb.gz	A8DYU9_DROME TNF-receptor-associated factor 4, isoform E OS=Drosophila melanogaster OX=7227 GN=Traf4 PE=4 SV=2
5	AFDB:Q9XYR0	0.656	0.637	1.456E-54	486	0.381	0.368	Q9XYR0.pdb.gz	Q9XYR0_DROME LD20987p OS=Drosophila melanogaster OX=7227 GN=Traf4 PE=1 SV=1
6	AFDB:Q6DEG0	0.308	0.254	1.325E-42	573	0.323	0.265	Q6DEG0.pdb.gz	Q6DEG0_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=zgc:92367 PE=2 SV=1
7	AFDB:Q13114	0.304	0.253	1.907E-40	568	0.294	0.243	Q13114.pdb.gz	TRAF3_HUMAN TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2
8	AFDB:P70191	0.309	0.261	2.708E-40	558	0.313	0.263	P70191.pdb.gz	TRAF5_MOUSE TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1
9	AFDB:O00463	0.305	0.258	4.859E-40	557	0.296	0.250	O00463.pdb.gz	TRAF5_HUMAN TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2
10	AFDB:Q9Y4K3	0.343	0.310	2.095E-39	522	0.277	0.249	Q9Y4K3.pdb.gz	TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1
11	PDB:5dkaA	0.156	0.642	1.775E-4	96	0.045	0.219	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:4r8pL	0.126	0.231	3.579E-4	254	0.047	0.087	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:5gm6a	0.120	0.419	2.770E-3	123	0.038	0.146	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:3m62A	0.132	0.066	7.059E-3	955	0.030	0.015	3m62A.pdb.gz
15	PDB:7qcdC	0.128	0.220	7.484E-3	267	0.038	0.067	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
16	PDB:7jzvA	0.126	0.229	3.044E-2	253	0.036	0.067	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
17	PDB:2c2lA	0.137	0.226	6.140E-2	281	0.026	0.043	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
18	PDB:5lj5t	0.104	0.112	6.510E-2	438	0.032	0.034	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
19	PDB:1zvfA	0.059	0.117	8.225E-2	176	0.045	0.119	1zvfA.pdb.gz
20	PDB:5a31B	0.098	0.473	1.238E-1	84	0.026	0.143	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F6SA91	0.0	798	437	0.823	0.886	F6SA91_HUMAN TNF receptor-associated factor OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1
2	Q61382	0.0	950	470	0.968	0.968	TRAF4_MOUSE TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2
3	Q7T1K2	0.0	803	470	0.768	0.768	Q7T1K2_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf4l PE=2 SV=1
4	Q9BUZ4	0.0	974	470	1.000	1.000	TRAF4_HUMAN TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1
5	Q9UAC5	5.90e-133	392	412	0.387	0.442	Q9UAC5_DROME TRAF1 OS=Drosophila melanogaster OX=7227 GN=Traf4 PE=2 SV=1
6	A8DYU9	3.47e-132	392	477	0.387	0.382	A8DYU9_DROME TNF-receptor-associated factor 4, isoform E OS=Drosophila melanogaster OX=7227 GN=Traf4 PE=4 SV=2
7	Q9XYR0	4.23e-131	390	486	0.385	0.372	Q9XYR0_DROME LD20987p OS=Drosophila melanogaster OX=7227 GN=Traf4 PE=1 SV=1
8	B5DFH7	5.67e-59	203	497	0.326	0.308	B5DFH7_RAT TNF receptor-associated factor OS=Rattus norvegicus OX=10116 GN=Traf2 PE=1 SV=1
9	Q12933	1.00e-58	203	501	0.315	0.295	TRAF2_HUMAN TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2
10	P39429	2.78e-58	201	501	0.328	0.307	TRAF2_MOUSE TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1
11	Q6DJN2	4.78e-53	189	556	0.298	0.252	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
12	P70196	9.20e-52	185	530	0.264	0.234	TRAF6_MOUSE TNF receptor-associated factor 6 OS=Mus musculus OX=10090 GN=Traf6 PE=1 SV=2
13	B5DF45	3.29e-51	183	530	0.264	0.234	TRAF6_RAT TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1
14	Q6IWL4	1.12e-49	179	542	0.279	0.242	TRAF6_DANRE TNF receptor-associated factor 6 OS=Danio rerio OX=7955 GN=traf6 PE=1 SV=2
15	Q6DEG0	6.75e-48	175	573	0.321	0.264	Q6DEG0_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=zgc:92367 PE=2 SV=1
16	E1C626	7.03e-48	174	545	0.268	0.231	E1C626_CHICK TNF receptor-associated factor OS=Gallus gallus OX=9031 GN=TRAF6 PE=1 SV=2
17	G5EG80	2.45e-46	169	462	0.264	0.268	G5EG80_CAEEL TNF Receptor Associated Factor (TRAF) homolog OS=Caenorhabditis elegans OX=6239 GN=trf-1 PE=2 SV=1
18	Q9Y4K3	2.74e-45	167	522	0.279	0.251	TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1
19	Q3MV19	1.79e-42	160	556	0.277	0.234	TRF6A_XENLA TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1
20	Q13114	5.13e-42	159	568	0.298	0.246	TRAF3_HUMAN TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00917 MATH	23	16.6	MATH domain
2	PF00097 zf-C3HC4	0.00044	31.4	Zinc finger, C3HC4 type (RING finger)
3	PF13923 zf-C3HC4_2	0.0063	27.6	Zinc finger, C3HC4 type (RING finger)
4	PF15227 zf-C3HC4_4	4.6	18.7	zinc finger of C3HC4-type, RING
5	PF11789 zf-Nse	0.21	22.9	Zinc-finger of the MIZ type in Nse subunit
6	PF12678 zf-rbx1	34	16.1	RING-H2 zinc finger domain
7	PF13639 zf-RING_2	0.92	21.2	Ring finger domain
8	PF14634 zf-RING_5	0.16	23.3	zinc-RING finger domain
9	PF14835 zf-RING_6	1.1	20.5	zf-RING of BARD1-type protein
10	PF13445 zf-RING_UBOX	0.012	27.0	RING-type zinc-finger
11	PF02176 zf-TRAF	4.1e-42	154.0	TRAF-type zinc finger
12	PF15965 zf-TRAF_2	11	18.0	TRAF-like zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262395

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000289473	0.982	Neutrophil cytosol factor 1
2	9606.ENSP00000300589	0.954	Nucleotide-binding oligomerization domain-containing protein 2
3	9606.ENSP00000378332	0.909	Transforming growth factor beta-1-induced transcript 1 protein
4	9606.ENSP00000308782	0.906	Platelet glycoprotein VI
5	9606.ENSP00000383382	0.873	Platelet glycoprotein Ib beta chain
6	9606.ENSP00000262435	0.823	E3 ubiquitin-protein ligase SMURF2
7	9606.ENSP00000354927	0.812	Mitogen-activated protein kinase kinase kinase 3
8	9606.ENSP00000358335	0.810	Mitogen-activated protein kinase kinase kinase 7
9	9606.ENSP00000358997	0.805	Interleukin-1 receptor-associated kinase 1
10	9606.ENSP00000228918	0.777	Tumor necrosis factor receptor superfamily member 3
11	9606.ENSP00000343535	0.773	Ubiquitin carboxyl-terminal hydrolase 7
12	9606.ENSP00000354621	0.771	E3 ubiquitin-protein ligase SMURF1
13	9606.ENSP00000375986	0.744	Mitogen-activated protein kinase kinase kinase 4
14	9606.ENSP00000275493	0.736	Epidermal growth factor receptor
15	9606.ENSP00000361359	0.729	Tumor necrosis factor receptor superfamily member 5
16	9606.ENSP00000325240	0.727	LIM and SH3 domain protein 1
17	9606.ENSP00000479910	0.720	Protein AF-17
18	9606.ENSP00000334044	0.715	Ubiquitin-like protein 4B
19	9606.ENSP00000225577	0.694	Ribosomal protein S6 kinase beta-1
20	9606.ENSP00000433623	0.684	TNF receptor-associated factor 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.999	enzyme binding
GO:0005102	0.890	signaling receptor binding
GO:0031625	0.729	ubiquitin protein ligase binding
GO:0032813	0.726	tumor necrosis factor receptor superfamily binding
GO:0019901	0.703	protein kinase binding
GO:0042802	0.659	identical protein binding
GO:0005164	0.336	tumor necrosis factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0048518	0.982	positive regulation of biological process
GO:0009987	0.974	cellular process
GO:0048583	0.973	regulation of response to stimulus
GO:0010646	0.959	regulation of cell communication
GO:0023051	0.955	regulation of signaling
GO:0009966	0.951	regulation of signal transduction
GO:0048522	0.914	positive regulation of cellular process
GO:0051338	0.902	regulation of transferase activity
GO:0001932	0.900	regulation of protein phosphorylation
GO:0050896	0.896	response to stimulus
GO:0045859	0.888	regulation of protein kinase activity
GO:0032501	0.877	multicellular organismal process
GO:0048856	0.858	anatomical structure development
GO:0043408	0.850	regulation of MAPK cascade
GO:0010604	0.839	positive regulation of macromolecule metabolic process
GO:0080135	0.838	regulation of cellular response to stress
GO:0048584	0.819	positive regulation of response to stimulus
GO:0070302	0.816	regulation of stress-activated protein kinase signaling cascade
GO:0051716	0.806	cellular response to stimulus
GO:0051173	0.797	positive regulation of nitrogen compound metabolic process
GO:0044093	0.789	positive regulation of molecular function
GO:0031325	0.775	positive regulation of cellular metabolic process
GO:0007154	0.757	cell communication
GO:1902533	0.747	positive regulation of intracellular signal transduction
GO:0023052	0.741	signaling
GO:0010562	0.727	positive regulation of phosphorus metabolic process
GO:0043410	0.706	positive regulation of MAPK cascade
GO:0007165	0.698	signal transduction
GO:0051247	0.683	positive regulation of protein metabolic process
GO:0007275	0.653	multicellular organism development
GO:0045937	0.651	positive regulation of phosphate metabolic process
GO:0032872	0.622	regulation of stress-activated MAPK cascade
GO:0008152	0.589	metabolic process
GO:0071704	0.573	organic substance metabolic process
GO:0044238	0.568	primary metabolic process
GO:0010468	0.537	regulation of gene expression
GO:0006807	0.533	nitrogen compound metabolic process
GO:0048513	0.508	animal organ development
GO:0042327	0.488	positive regulation of phosphorylation
GO:0031401	0.484	positive regulation of protein modification process
GO:0051347	0.461	positive regulation of transferase activity
GO:0007585	0.457	respiratory gaseous exchange by respiratory system
GO:0031326	0.439	regulation of cellular biosynthetic process
GO:0001934	0.439	positive regulation of protein phosphorylation
GO:0019219	0.433	regulation of nucleobase-containing compound metabolic process
GO:0046328	0.432	regulation of JNK cascade
GO:0010556	0.429	regulation of macromolecule biosynthetic process
GO:0070304	0.426	positive regulation of stress-activated protein kinase signaling cascade
GO:0045860	0.425	positive regulation of protein kinase activity
GO:0032874	0.418	positive regulation of stress-activated MAPK cascade
GO:0043170	0.398	macromolecule metabolic process
GO:0051252	0.387	regulation of RNA metabolic process
GO:0046330	0.386	positive regulation of JNK cascade
GO:0006355	0.367	regulation of DNA-templated transcription
GO:0042221	0.322	response to chemical
GO:1901564	0.301	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005730	0.989	nucleolus
GO:0001650	0.959	fibrillar center
GO:0016020	0.427	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]