StarFunc result for job id Q9BV10

User Input

>input (488 residues)
MAGKGSSGRRPLLLGLLVAVATVHLVICPYTKVEESFNLQATHDLLYHWQDLEQYDHLEF
PGVVPRTFLGPVVIAVFSSPAVYVLSLLEMSKFYSQLIVRGVLGLGVIFGLWTLQKEVRR
HFGAMVATMFCWVTAMQFHLMFYCTRTLPNVLALPVVLLALAAWLRHEWARFIWLSAFAI
IVFRVELCLFLGLLLLLALGNRKVSVVRALRHAVPAGILCLGLTVAVDSYFWRQLTWPEG
KVLWYNTVLNKSSNWGTSPLLWYFYSALPRGLGCSLLFIPLGLVDRRTHAPTVLALGFMA
LYSLLPHKELRFIIYAFPMLNITAARGCSYLLNNYKKSWLYKAGSLLVIGHLVVNAAYSA
TALYVSHFNYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDV
QPGTGMLAYTHILMEAAPGLLALYRDTHRVLASVVGTTGVSLNLTQLPPFNVHLQTKLVL
LERLPRPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BV10	1.000	1.000	1.360E-71	488	1.000	1.000	Q9BV10.pdb.gz	ALG12_HUMAN Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG12 PE=1 SV=1
2	AFDB:A8MR93	0.939	0.922	2.734E-37	497	0.389	0.382	A8MR93.pdb.gz	ALG12_ARATH Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG12 PE=1 SV=1
3	AFDB:Q9USD4	0.898	0.805	7.389E-31	546	0.303	0.271	Q9USD4.pdb.gz	ALG12_SCHPO Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg12 PE=3 SV=2
4	AFDB:P53730	0.906	0.806	2.074E-29	551	0.309	0.274	P53730.pdb.gz	ALG12_YEAST Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG12 PE=1 SV=1
5	AFDB:Q586R8	0.817	0.535	6.335E-22	758	0.314	0.202	Q586R8.pdb.gz	Q586R8_TRYB2 Mannosyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.220 PE=3 SV=1
6	AFDB:Q9JJQ0	0.735	0.669	5.093E-16	542	0.209	0.188	Q9JJQ0.pdb.gz	PIGB_MOUSE GPI mannosyltransferase 3 OS=Mus musculus OX=10090 GN=Pigb PE=2 SV=2
7	AFDB:Q92521	0.709	0.632	1.570E-15	554	0.193	0.170	Q92521.pdb.gz	PIGB_HUMAN GPI mannosyltransferase 3 OS=Homo sapiens OX=9606 GN=PIGB PE=1 SV=1
8	AFDB:Q9VBV8	0.774	0.619	2.021E-14	623	0.186	0.146	Q9VBV8.pdb.gz	Q9VBV8_DROME Mannosyltransferase OS=Drosophila melanogaster OX=7227 GN=Alg9 PE=2 SV=1
9	AFDB:Q94A15	0.720	0.648	4.601E-14	548	0.193	0.172	Q94A15.pdb.gz	APTG1_ARATH Mannosyltransferase APTG1 OS=Arabidopsis thaliana OX=3702 GN=APTG1 PE=2 SV=1
10	AFDB:P86935	0.708	0.626	5.714E-14	558	0.176	0.154	P86935.pdb.gz	GPI10_TRYBB GPI mannosyltransferase 3 OS=Trypanosoma brucei brucei OX=5702 GN=GPI10 PE=2 SV=1
11	PDB:6s7tA	0.539	0.395	5.222E-6	706	0.129	0.089	6s7tA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
12	PDB:6s7oA	0.542	0.425	3.083E-5	656	0.143	0.107	6s7oA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
13	PDB:3rceA	0.485	0.370	7.992E-5	683	0.111	0.079	3rceA.pdb.gz	X-ray structure of a bacterial oligosaccharyltransferase.
14	PDB:6eznF	0.543	0.428	1.344E-4	650	0.117	0.088	6eznF.pdb.gz	Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase.
15	PDB:5oglA	0.459	0.340	1.820E-4	707	0.131	0.091	5oglA.pdb.gz	Molecular basis of lipid-linked oligosaccharide recognition and processing by bacterial oligosaccharyltransferase.
16	PDB:7w72U	0.351	0.394	8.586E-3	420	0.111	0.129	7w72U.pdb.gz	Structure of human glycosylphosphatidylinositol transamidase.
17	PDB:7bvfB	0.398	0.212	6.027E-2	1054	0.129	0.060	7bvfB.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.
18	PDB:7bvfA	0.414	0.216	8.160E-2	1087	0.115	0.052	7bvfA.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.
19	PDB:6p25B	0.312	0.232	1.314E-1	690	0.059	0.042	6p25B.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
20	PDB:7c76B	0.103	0.104	1.858E-1	483	0.133	0.135	7c76B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BV10	0.0	986	488	1.000	1.000	ALG12_HUMAN Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG12 PE=1 SV=1
2	A8MR93	1.33e-114	348	497	0.365	0.358	ALG12_ARATH Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG12 PE=1 SV=1
3	P53730	6.13e-65	221	551	0.318	0.281	ALG12_YEAST Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG12 PE=1 SV=1
4	Q9USD4	1.42e-59	207	546	0.307	0.275	ALG12_SCHPO Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg12 PE=3 SV=2
5	Q586R8	4.08e-26	114	758	0.238	0.153	Q586R8_TRYB2 Mannosyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.220 PE=3 SV=1
6	Q92521	1.09e-10	66.2	554	0.137	0.121	PIGB_HUMAN GPI mannosyltransferase 3 OS=Homo sapiens OX=9606 GN=PIGB PE=1 SV=1
7	Q9JJQ0	8.60e-10	63.2	542	0.125	0.113	PIGB_MOUSE GPI mannosyltransferase 3 OS=Mus musculus OX=10090 GN=Pigb PE=2 SV=2
8	Q94A15	3.66e-08	58.2	548	0.164	0.146	APTG1_ARATH Mannosyltransferase APTG1 OS=Arabidopsis thaliana OX=3702 GN=APTG1 PE=2 SV=1
9	P30777	5.28e-07	54.7	616	0.170	0.135	GPI10_YEAST GPI mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI10 PE=1 SV=2
10	Q9VBV8	2.91e-06	52.4	623	0.121	0.095	Q9VBV8_DROME Mannosyltransferase OS=Drosophila melanogaster OX=7227 GN=Alg9 PE=2 SV=1
11	Q9H6U8	7.07e-05	47.8	611	0.174	0.139	ALG9_HUMAN Alpha-1,2-mannosyltransferase ALG9 OS=Homo sapiens OX=9606 GN=ALG9 PE=1 SV=2
12	Q9P7Q9	8.73e-05	47.4	577	0.145	0.123	ALG9_SCHPO Alpha-1,2-mannosyltransferase alg9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg9 PE=3 SV=1
13	Q9FZ49	8.76e-05	47.4	570	0.125	0.107	ALG9_ARATH Dol-P-Man:Man(6)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG9 PE=1 SV=1
14	B4DYW0	3.70e-04	45.4	844	0.172	0.100	B4DYW0_HUMAN Mannosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
15	P86935	0.002	43.1	558	0.125	0.109	GPI10_TRYBB GPI mannosyltransferase 3 OS=Trypanosoma brucei brucei OX=5702 GN=GPI10 PE=2 SV=1
16	P86936	0.003	42.4	558	0.125	0.109	GPI10_TRYB2 GPI mannosyltransferase 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=GPI10 PE=3 SV=1
17	P53868	0.021	39.7	555	0.152	0.133	ALG9_YEAST Alpha-1,2-mannosyltransferase ALG9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG9 PE=1 SV=1
18	Q19130	0.12	37.4	725	0.051	0.034	Q19130_CAEEL glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Caenorhabditis elegans OX=6239 GN=gfat-1 PE=1 SV=1
19	Q4WPG0	0.31	36.2	771	0.154	0.097	GPI10_ASPFU GPI mannosyltransferase 3 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=gpi10 PE=3 SV=1
20	Q9USN0	0.44	35.4	506	0.084	0.081	GPI10_SCHPO GPI mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi10 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19217 CoV_NSP4_N	8.6e+02	10.5	Coronavirus replicase NSP4, N-terminal
2	PF03901 Glyco_transf_22	1.3e-39	148.2	Alg9-like mannosyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333813

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482396	0.998	Alpha-1,2-mannosyltransferase ALG9
2	9606.ENSP00000380793	0.987	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
3	9606.ENSP00000482437	0.987	Mannosyltransferase
4	9606.ENSP00000239891	0.969	ALG5, dolichyl-phosphate beta-glucosyltransferase
5	9606.ENSP00000360149	0.948	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase
6	9606.ENSP00000299626	0.941	Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase
7	9606.ENSP00000266483	0.910	Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
8	9606.ENSP00000310120	0.880	Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
9	9606.ENSP00000430236	0.863	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
10	9606.ENSP00000319979	0.853	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1
11	9606.ENSP00000359224	0.826	UDP-N-acetylglucosamine transferase subunit ALG14 homolog
12	9606.ENSP00000378260	0.824	Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13
13	9606.ENSP00000360644	0.819	Dolichol-phosphate mannosyltransferase subunit 1
14	9606.ENSP00000386597	0.814	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
15	9606.ENSP00000262374	0.812	Chitobiosyldiphosphodolichol beta-mannosyltransferase
16	9606.ENSP00000376472	0.807	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
17	9606.ENSP00000295770	0.803	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B
18	9606.ENSP00000413405	0.777	GPI mannosyltransferase 4
19	9606.ENSP00000399457	0.756	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
20	9606.ENSP00000378958	0.743	Rab-like protein 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000030	1.000	mannosyltransferase activity
GO:0005488	0.711	binding
GO:0005515	0.372	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.999	cellular metabolic process
GO:0044238	0.998	primary metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0006490	0.985	oligosaccharide-lipid intermediate biosynthetic process
GO:0006487	0.985	protein N-linked glycosylation
GO:0006488	0.358	dolichol-linked oligosaccharide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]