StarFunc result for job id Q9BV23

User Input

>input (337 residues)
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYST
DNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BV23	1.000	1.000	3.204E-68	337	1.000	1.000	Q9BV23.pdb.gz	ABHD6_HUMAN Monoacylglycerol lipase ABHD6 OS=Homo sapiens OX=9606 GN=ABHD6 PE=1 SV=1
2	AFDB:Q1QEU6	0.791	0.843	4.620E-23	315	0.202	0.216	Q1QEU6.pdb.gz	Q1QEU6_PSYCK Alpha/beta hydrolase fold protein OS=Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5) OX=335284 GN=Pcryo_0023 PE=1 SV=1
3	AFDB:Q9AQM4	0.709	0.814	1.179E-20	290	0.175	0.203	Q9AQM4.pdb.gz	CARC_PSERE 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid hydrolase OS=Pseudomonas resinovorans OX=53412 GN=carC PE=1 SV=1
4	AFDB:P9WNH5	0.656	0.751	1.515E-18	291	0.172	0.199	P9WNH5.pdb.gz	HSAD_MYCTU 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hsaD PE=1 SV=1
5	PDB:5jzsB	0.670	0.785	3.440E-18	284	0.169	0.201	5jzsB.pdb.gz	Investigation of the mycobacterial enzyme HsaD as a potential novel target for anti-tubercular agents using a fragment-based drug design approach.
6	AFDB:P77044	0.656	0.759	1.872E-17	288	0.163	0.191	P77044.pdb.gz	MHPC_ECOLI 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mhpC PE=1 SV=4
7	AFDB:Q9H6B9	0.571	0.538	2.353E-17	360	0.202	0.189	Q9H6B9.pdb.gz	EPHX3_HUMAN Epoxide hydrolase 3 OS=Homo sapiens OX=9606 GN=EPHX3 PE=1 SV=1
8	AFDB:G5EBI4	0.582	0.494	2.792E-17	404	0.211	0.176	G5EBI4.pdb.gz	CEEH1_CAEEL Epoxide hydrolase 1 OS=Caenorhabditis elegans OX=6239 GN=ceeh-1 PE=1 SV=1
9	AFDB:P53750	0.704	0.808	3.315E-17	290	0.172	0.200	P53750.pdb.gz	YN93_YEAST Uncharacterized hydrolase YNR064C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNR064C PE=3 SV=1
10	AFDB:O22975	0.678	0.558	3.716E-17	418	0.205	0.165	O22975.pdb.gz	LPAAT_ARATH 1-acylglycerol-3-phosphate O-acyltransferase OS=Arabidopsis thaliana OX=3702 GN=At4g24160 PE=1 SV=1
11	AFDB:P9WNH3	0.667	0.660	4.670E-17	341	0.199	0.196	P9WNH3.pdb.gz	Y2715_MYCTU Uncharacterized protein Rv2715 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2715 PE=1 SV=1
12	PDB:1u2eA	0.670	0.777	5.340E-17	286	0.151	0.178	1u2eA.pdb.gz
13	PDB:3afiB	0.618	0.682	2.228E-16	302	0.148	0.166	3afiB.pdb.gz
14	PDB:2zjfA	0.587	0.573	5.783E-15	346	0.139	0.136	2zjfA.pdb.gz	The molecular structure of epoxide hydrolase B from Mycobacterium tuberculosis and its complex with a urea-based inhibitor.
15	PDB:3kxpA	0.606	0.747	1.024E-14	268	0.131	0.164	3kxpA.pdb.gz
16	PDB:4gdmC	0.579	0.728	4.523E-14	259	0.163	0.212	4gdmC.pdb.gz	Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
17	PDB:3e3aB	0.572	0.690	5.070E-14	275	0.148	0.182	3e3aB.pdb.gz
18	PDB:1q0rA	0.621	0.696	5.368E-14	297	0.148	0.168	1q0rA.pdb.gz	Crystal structure of aclacinomycin methylesterase with bound product analogues: implications for anthracycline recognition and mechanism.
19	PDB:2vavB	0.596	0.576	6.747E-14	350	0.145	0.140	2vavB.pdb.gz	The last step in cephalosporin C formation revealed: crystal structures of deacetylcephalosporin C acetyltransferase from Acremonium chrysogenum in complexes with reaction intermediates.
20	PDB:1cr6B	0.590	0.385	1.006E-13	541	0.145	0.091	1cr6B.pdb.gz	Detoxification of environmental mutagens and carcinogens: structure, mechanism, and evolution of liver epoxide hydrolase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R2Y0	0.0	661	336	0.932	0.935	ABHD6_MOUSE Monoacylglycerol lipase ABHD6 OS=Mus musculus OX=10090 GN=Abhd6 PE=1 SV=1
2	Q9BV23	0.0	703	337	1.000	1.000	ABHD6_HUMAN Monoacylglycerol lipase ABHD6 OS=Homo sapiens OX=9606 GN=ABHD6 PE=1 SV=1
3	Q1QEU6	5.09e-21	94.0	315	0.190	0.203	Q1QEU6_PSYCK Alpha/beta hydrolase fold protein OS=Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5) OX=335284 GN=Pcryo_0023 PE=1 SV=1
4	P9WNH5	3.09e-16	80.1	291	0.211	0.244	HSAD_MYCTU 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hsaD PE=1 SV=1
5	P9WNH3	2.79e-13	72.0	341	0.217	0.214	Y2715_MYCTU Uncharacterized protein Rv2715 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2715 PE=1 SV=1
6	P53750	1.07e-11	66.6	290	0.184	0.214	YN93_YEAST Uncharacterized hydrolase YNR064C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNR064C PE=3 SV=1
7	O22975	1.51e-10	64.3	418	0.214	0.172	LPAAT_ARATH 1-acylglycerol-3-phosphate O-acyltransferase OS=Arabidopsis thaliana OX=3702 GN=At4g24160 PE=1 SV=1
8	Q9AQM4	8.71e-10	61.2	290	0.163	0.190	CARC_PSERE 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid hydrolase OS=Pseudomonas resinovorans OX=53412 GN=carC PE=1 SV=1
9	P77044	3.41e-09	59.3	288	0.172	0.201	MHPC_ECOLI 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mhpC PE=1 SV=4
10	G5EBI4	8.97e-09	58.5	404	0.217	0.181	CEEH1_CAEEL Epoxide hydrolase 1 OS=Caenorhabditis elegans OX=6239 GN=ceeh-1 PE=1 SV=1
11	O23227	1.13e-08	58.2	378	0.205	0.183	O23227_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=C7A10.830 PE=1 SV=2
12	Q9H6B9	1.29e-07	55.1	360	0.184	0.172	EPHX3_HUMAN Epoxide hydrolase 3 OS=Homo sapiens OX=9606 GN=EPHX3 PE=1 SV=1
13	Q9K197	6.32e-07	52.4	258	0.163	0.213	BIOH_NEIMB Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=bioH PE=3 SV=2
14	Q8VYJ0	1.73e-06	51.6	382	0.202	0.178	Q8VYJ0_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL2 PE=1 SV=1
15	A0QNZ7	3.72e-06	50.1	280	0.178	0.214	MGLL_MYCS2 Monoacylglycerol lipase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_0220 PE=1 SV=1
16	Q6F9F4	4.13e-06	49.7	263	0.080	0.103	TGND_ACIAD (E)-2-((N-methylformamido)methylene)succinate hydrolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=tgnD PE=1 SV=1
17	Q8NFV4	8.37e-06	49.3	315	0.184	0.197	ABHDB_HUMAN Protein ABHD11 OS=Homo sapiens OX=9606 GN=ABHD11 PE=1 SV=1
18	G5EDL5	9.08e-06	49.3	355	0.169	0.161	CEEH2_CAEEL Epoxide hydrolase 2 OS=Caenorhabditis elegans OX=6239 GN=ceeh-2 PE=1 SV=1
19	P37355	2.43e-05	47.4	252	0.181	0.242	MENH_ECOLI 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase OS=Escherichia coli (strain K12) OX=83333 GN=menH PE=1 SV=2
20	P75895	2.63e-05	47.4	266	0.163	0.207	RUTD_ECOLI Putative carbamate hydrolase RutD OS=Escherichia coli (strain K12) OX=83333 GN=rutD PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	4.1e-22	90.6	alpha/beta hydrolase fold
2	PF20408 Abhydrolase_11	23	16.1	Alpha/beta hydrolase domain
3	PF12697 Abhydrolase_6	6.5e-18	77.7	Alpha/beta hydrolase family
4	PF08840 BAAT_C	92	14.6	BAAT / Acyl-CoA thioester hydrolase C terminal
5	PF01738 DLH	29	15.7	Dienelactone hydrolase family
6	PF06342 DUF1057	7.5	17.1	Alpha/beta hydrolase of unknown function (DUF1057)
7	PF03959 FSH1	4.2	18.5	Serine hydrolase (FSH1)
8	PF12146 Hydrolase_4	7.2e-14	63.2	Serine aminopeptidase, S33
9	PF03096 Ndr	0.0057	27.0	Ndr family
10	PF02089 Palm_thioest	3.6	18.8	Palmitoyl protein thioesterase
11	PF06821 Ser_hydrolase	1.3e+02	13.9	Serine hydrolase
12	PF00975 Thioesterase	2.2e+02	13.4	Thioesterase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420315

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365725	0.942	Monoacylglycerol lipase ABHD12
2	9606.ENSP00000265052	0.890	Monoglyceride lipase
3	9606.ENSP00000257215	0.877	Sn1-specific diacylglycerol lipase alpha
4	9606.ENSP00000407112	0.867	N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D
5	9606.ENSP00000243167	0.857	Fatty-acid amide hydrolase 1
6	9606.ENSP00000297056	0.839	Sn1-specific diacylglycerol lipase beta
7	9606.ENSP00000428994	0.781	Glutamate receptor 1
8	9606.ENSP00000358513	0.759	Cannabinoid receptor 1
9	9606.ENSP00000222800	0.752	Protein ABHD11
10	9606.ENSP00000379282	0.752	Phosphatidylserine (PS) lipase that mediates the hydrolysis of phosphatidylserine to generate lysophosphatidylserine (LPS) (By similarity). LPS constitutes a class of signaling lipids that regulates immunological and neurological processes (By similarity). Has no activity towards diacylglycerol, triacylglycerol or lysophosphatidylserine lipase . Also has monoacylglycerol lipase activity, with preference for 1-(9Z,12Z- octadecadienoyl)-glycerol (1-LG) and 2-glyceryl-15-deoxy-Delta(12,14)- prostaglandin J2 (15d-PGJ(2)-G) .
11	9606.ENSP00000414558	0.746	Protein ABHD4
12	9606.ENSP00000477141	0.731	DOMON domain-containing protein FRRS1L
13	9606.ENSP00000459962	0.719	Transient receptor potential cation channel, subfamily V, member 1
14	9606.ENSP00000461007	0.719	Transient receptor potential cation channel subfamily V member 1
15	9606.ENSP00000442464	0.672	Neutral cholesterol ester hydrolase 1
16	9606.ENSP00000289119	0.655	Phospholipase ABHD3
17	9606.ENSP00000261386	0.637	Glycerophosphodiester phosphodiesterase 1
18	9606.ENSP00000382428	0.636	Disks large homolog 4
19	9606.ENSP00000375894	0.635	G-protein coupled receptor 55
20	9606.ENSP00000286733	0.624	N-acylethanolamine-hydrolyzing acid amidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047372	1.000	acylglycerol lipase activity
GO:0005515	0.992	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006639	0.967	acylglycerol metabolic process
GO:0046503	0.955	glycerolipid catabolic process
GO:0046464	0.947	acylglycerol catabolic process
GO:0032787	0.653	monocarboxylic acid metabolic process
GO:0065007	0.570	biological regulation
GO:0050789	0.477	regulation of biological process
GO:0006631	0.467	fatty acid metabolic process
GO:0050794	0.439	regulation of cellular process
GO:0001676	0.329	long-chain fatty acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.952	membrane-bounded organelle
GO:0043229	0.949	intracellular organelle
GO:0043231	0.941	intracellular membrane-bounded organelle
GO:0012505	0.926	endomembrane system
GO:0005737	0.926	cytoplasm
GO:0031090	0.781	organelle membrane
GO:0098588	0.319	bounding membrane of organelle
GO:0031982	0.305	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34019	1.000	a 1-acylglycerol + H2O = a fatty acid + glycerol + H(+)
EC:3.1.1.23	1.000	acylglycerol lipase.

[back to server]