StarFunc result for job id Q9BV35

User Input

>input (468 residues)
MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDA
DPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEK
ILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSKQEK
LTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMVLEGGIRS
LWRGNGINVLKIAPESAIKFMAYEQIKRAILGQQETLHVQERFVAGSLAGATAQTIIYPM
EVLKTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLK
NWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQASIEGGPQLSMLG
LLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BV35	1.000	1.000	8.132E-67	468	1.000	1.000	Q9BV35.pdb.gz	SCMC3_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Homo sapiens OX=9606 GN=SLC25A23 PE=1 SV=2
2	AFDB:Q6NUK1	0.814	0.801	3.800E-44	477	0.609	0.597	Q6NUK1.pdb.gz	SCMC1_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2
3	AFDB:A2CEQ0	0.834	0.833	4.028E-43	469	0.620	0.618	A2CEQ0.pdb.gz	SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio OX=7955 GN=slc25a25b PE=3 SV=2
4	AFDB:A2ASZ8	0.835	0.833	1.524E-42	469	0.626	0.625	A2ASZ8.pdb.gz	SCMC2_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A25 OS=Mus musculus OX=10090 GN=Slc25a25 PE=1 SV=1
5	AFDB:B1AUS6	0.818	0.810	4.799E-40	473	0.509	0.503	B1AUS6.pdb.gz	B1AUS6_MOUSE Solute carrier family 25, member 54 OS=Mus musculus OX=10090 GN=Slc25a54 PE=1 SV=1
6	AFDB:Q9LY28	0.663	0.649	1.338E-31	479	0.397	0.388	Q9LY28.pdb.gz	MAPC3_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 3 OS=Arabidopsis thaliana OX=3702 GN=APC3 PE=1 SV=1
7	AFDB:Q9FLS8	0.658	0.645	2.440E-31	478	0.402	0.393	Q9FLS8.pdb.gz	MAPC1_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 1 OS=Arabidopsis thaliana OX=3702 GN=APC1 PE=1 SV=1
8	AFDB:Q9FI43	0.649	0.628	3.346E-30	487	0.402	0.386	Q9FI43.pdb.gz	MAPC2_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 2 OS=Arabidopsis thaliana OX=3702 GN=APC2 PE=1 SV=1
9	AFDB:Q8BVN7	0.576	0.843	4.112E-25	312	0.404	0.606	Q8BVN7.pdb.gz	S2541_MOUSE Calcium-independent mitochondrial carrier protein SCaMC-3L OS=Mus musculus OX=10090 GN=Slc25a41 PE=1 SV=1
10	AFDB:Q6I583	0.565	0.733	2.083E-19	355	0.250	0.330	Q6I583.pdb.gz	Q6I583_ORYSJ Os05g0585900 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0585900 PE=1 SV=1
11	PDB:4c9qB	0.507	0.790	1.396E-12	290	0.154	0.248	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.484	0.748	8.115E-12	293	0.173	0.276	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.354	0.509	2.345E-9	292	0.179	0.288	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:5a2hA	0.149	0.412	1.490E-5	147	0.075	0.238	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
15	PDB:1osaA	0.154	0.418	2.013E-5	148	0.077	0.243	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
16	PDB:5d43A	0.141	0.408	2.193E-5	150	0.066	0.207	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
17	PDB:1ggzA	0.142	0.425	4.958E-5	144	0.071	0.229	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
18	PDB:3qrxA	0.158	0.440	4.958E-5	145	0.077	0.248	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.
19	PDB:1hqvA	0.176	0.373	6.145E-5	178	0.077	0.202	1hqvA.pdb.gz	Structure of apoptosis-linked protein ALG-2: insights into Ca2+-induced changes in penta-EF-hand proteins.
20	PDB:2f2pA	0.143	0.366	6.414E-5	169	0.075	0.207	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2ASZ8	0.0	622	469	0.626	0.625	SCMC2_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A25 OS=Mus musculus OX=10090 GN=Slc25a25 PE=1 SV=1
2	A2CEQ0	0.0	613	469	0.620	0.618	SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio OX=7955 GN=slc25a25b PE=3 SV=2
3	Q6GQS1	0.0	896	467	0.936	0.938	SCMC3_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Mus musculus OX=10090 GN=Slc25a23 PE=1 SV=1
4	Q6NUK1	0.0	618	477	0.611	0.600	SCMC1_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2
5	Q8BMD8	0.0	610	475	0.618	0.608	SCMC1_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Mus musculus OX=10090 GN=Slc25a24 PE=1 SV=1
6	Q9BV35	0.0	959	468	1.000	1.000	SCMC3_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Homo sapiens OX=9606 GN=SLC25A23 PE=1 SV=2
7	B1AUS6	1.10e-179	513	473	0.506	0.501	B1AUS6_MOUSE Solute carrier family 25, member 54 OS=Mus musculus OX=10090 GN=Slc25a54 PE=1 SV=1
8	Q9D5G5	3.28e-179	511	473	0.506	0.501	Q9D5G5_MOUSE EF-hand domain-containing protein OS=Mus musculus OX=10090 GN=Slc25a54 PE=2 SV=1
9	Q8BVN7	5.99e-127	372	312	0.417	0.625	S2541_MOUSE Calcium-independent mitochondrial carrier protein SCaMC-3L OS=Mus musculus OX=10090 GN=Slc25a41 PE=1 SV=1
10	Q9FLS8	5.99e-111	338	478	0.415	0.406	MAPC1_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 1 OS=Arabidopsis thaliana OX=3702 GN=APC1 PE=1 SV=1
11	Q9FI43	1.91e-107	329	487	0.406	0.390	MAPC2_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 2 OS=Arabidopsis thaliana OX=3702 GN=APC2 PE=1 SV=1
12	Q9LY28	1.22e-103	319	479	0.400	0.390	MAPC3_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 3 OS=Arabidopsis thaliana OX=3702 GN=APC3 PE=1 SV=1
13	Q6I583	1.99e-62	208	355	0.250	0.330	Q6I583_ORYSJ Os05g0585900 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0585900 PE=1 SV=1
14	F4JHS4	8.99e-60	202	366	0.244	0.311	F4JHS4_ARATH Adenine nucleotide transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ADNT1 PE=1 SV=1
15	O94502	2.71e-54	189	426	0.244	0.268	YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12D12.05c PE=3 SV=2
16	Q8C0K5	1.58e-53	184	332	0.229	0.322	GDC_MOUSE Solute carrier family 25 member 16 OS=Mus musculus OX=10090 GN=Slc25a16 PE=1 SV=1
17	Q0P483	3.00e-53	183	321	0.229	0.333	S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio OX=7955 GN=slc25a42 PE=2 SV=1
18	B4F8I5	9.69e-53	182	335	0.226	0.316	COAC2_MAIZE Mitochondrial carrier protein CoAc2 OS=Zea mays OX=4577 GN=COAC2 PE=2 SV=1
19	P16260	2.08e-52	181	332	0.220	0.310	GDC_HUMAN Solute carrier family 25 member 16 OS=Homo sapiens OX=9606 GN=SLC25A16 PE=1 SV=3
20	Q9M058	1.91e-51	179	332	0.231	0.325	Q9M058_ARATH Ca-dependent solute carrier-like protein OS=Arabidopsis thaliana OX=3702 GN=F1I16_50 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05042 Caleosin	1.1e+02	14.1	Caleosin related protein
2	PF00036 EF-hand_1	6.7e-13	58.3	EF hand
3	PF13202 EF-hand_5	3.6e-09	46.9	EF hand
4	PF13405 EF-hand_6	7.6e-12	55.1	EF-hand domain
5	PF13499 EF-hand_7	1.6e-14	65.4	EF-hand domain pair
6	PF13833 EF-hand_8	0.047	24.8	EF-hand domain pair
7	PF14658 EF-hand_9	3.6	19.4	EF-hand domain
8	PF00153 Mito_carr	1.5e-68	238.1	Mitochondrial carrier protein
9	PF18405 SLC25_like	1.4e+02	12.9	Mitochondrial SLC25 homolog
10	PF10591 SPARC_Ca_bdg	0.24	23.2	Secreted protein acidic and rich in cysteine Ca binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301454

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368468	0.839	Mitochondrial calcium uniporter regulator 1
2	9606.ENSP00000362144	0.837	Calcium uniporter protein, mitochondrial
3	9606.ENSP00000378145	0.821	Calcium uniporter regulatory subunit MCUb, mitochondrial
4	9606.ENSP00000354415	0.780	Calcium uptake protein 1, mitochondrial
5	9606.ENSP00000371811	0.766	Calcium uptake protein 2, mitochondrial
6	9606.ENSP00000362159	0.692	Calcium-binding mitochondrial carrier protein SCaMC-2
7	9606.ENSP00000278193	0.603	Protein lin-7 homolog C
8	9606.ENSP00000321455	0.565	Calcium uptake protein 3, mitochondrial
9	9606.ENSP00000327467	0.562	Essential MCU regulator, mitochondrial
10	9606.ENSP00000239461	0.546	Paired mesoderm homeobox protein 1
11	9606.ENSP00000361580	0.541	Zinc finger protein 691
12	9606.ENSP00000425587	0.539	Exocyst complex component 3
13	9606.ENSP00000468927	0.533	Signal transducing adaptor family member 2
14	9606.ENSP00000263578	0.526	FAD-dependent oxidoreductase domain-containing protein 1
15	9606.ENSP00000371607	0.514	Mitochondrial intermediate peptidase
16	9606.ENSP00000469029	0.511	Zinc finger protein 574
17	9606.ENSP00000478931	0.505	Apoptosis-inducing factor 2
18	9606.ENSP00000481314	0.504	Sorting nexin-12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022857	0.998	transmembrane transporter activity
GO:0005509	0.998	calcium ion binding
GO:0005515	0.996	protein binding
GO:0008514	0.932	organic anion transmembrane transporter activity
GO:1901702	0.923	salt transmembrane transporter activity
GO:0015215	0.850	nucleotide transmembrane transporter activity
GO:0015216	0.841	purine nucleotide transmembrane transporter activity
GO:0000295	0.819	adenine nucleotide transmembrane transporter activity
GO:0005347	0.700	ATP transmembrane transporter activity
GO:0015318	0.378	inorganic molecular entity transmembrane transporter activity
GO:0015217	0.315	ADP transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0051179	0.970	localization
GO:0065007	0.935	biological regulation
GO:0051234	0.925	establishment of localization
GO:0006810	0.920	transport
GO:0071702	0.870	organic substance transport
GO:0050794	0.769	regulation of cellular process
GO:0055085	0.671	transmembrane transport
GO:1990542	0.471	mitochondrial transmembrane transport
GO:0050896	0.365	response to stimulus
GO:0008152	0.308	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.363	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]