StarFunc result for job id Q9BV44

User Input

>input (507 residues)
MCDIEEATNQLLDVNLHENQKSVQVTESDLGSESELLVTIGATVPTGFEQTAADEVREKL
GSSCKISRDRGKIYFVISVESLAQVHCLRSVDNLFVVVQEFQDYQFKQTKEEVLKDFEDL
AGKLPWSNPLKVWKINASFKKKKAKRKKINQNSSKEKINNGQEVKIDQRNVKKEFTSHAL
DSHILDYYENPAIKEDVSTLIGDDLASCKDETDESSKEETEPQVLKFRVTCNRAGEKHCF
TSNEAARDFGGAVQDYFKWKADMTNFDVEVLLNIHDNEVIVGIALTEESLHRRNITHFGP
TTLRSTLAYGMLRLCDPLPYDIIVDPMCGTGAIPIEGATEWSDCFHIAGDNNPLAVNRAA
NNIASLLTKSQIKEGKPSWGLPIDAVQWDICNLPLRTGSVDIIVTDLPFGKRMGSKKRNW
NLYPACLREMSRVCTPTTGRAVLLTQDTKCFTKALSGMRHVWRKVDTVWVNVGGLRAAVY
VLIRTPQAFVHPSEQDGERGTLWQCKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R2D3	0.847	0.847	3.056E-96	507	1.000	1.000	A0A024R2D3.pdb.gz
2	AFDB:Q9BTF0	0.641	0.646	1.383E-32	503	0.229	0.231	Q9BTF0.pdb.gz	THUM2_HUMAN THUMP domain-containing protein 2 OS=Homo sapiens OX=9606 GN=THUMPD2 PE=1 SV=2
3	AFDB:Q57880	0.590	0.777	3.897E-27	381	0.178	0.236	Q57880.pdb.gz	TRM14_METJA tRNA (guanine(6)-N2)-methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=trm14 PE=1 SV=1
4	AFDB:A0A0H2UNG1	0.564	0.730	1.747E-21	385	0.156	0.205	A0A0H2UNG1.pdb.gz	A0A0H2UNG1_STRPN THUMP domain-containing protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0373 PE=1 SV=1
5	PDB:3v97A	0.533	0.416	1.557E-17	667	0.148	0.112	3v97A.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA
6	AFDB:Q9UY84	0.380	0.518	1.515E-14	329	0.114	0.176	Q9UY84.pdb.gz	TMG10_PYRAB tRNA (guanine(10)-N2)-dimethyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=trmG10 PE=1 SV=2
7	PDB:3v97B	0.493	0.400	3.210E-13	641	0.130	0.103	3v97B.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA
8	AFDB:O94636	0.362	0.384	8.345E-13	469	0.112	0.122	O94636.pdb.gz	TRM11_SCHPO tRNA (guanine(10)-N2)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm11 PE=3 SV=2
9	AFDB:Q9LSR5	0.292	0.479	1.308E-10	292	0.071	0.123	Q9LSR5.pdb.gz	Q9LSR5_ARATH At5g54400 OS=Arabidopsis thaliana OX=3702 GN=At5g54400 PE=2 SV=1
10	PDB:4b17A	0.261	0.345	2.414E-10	357	0.089	0.126	4b17A.pdb.gz	Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
11	PDB:4f86A	0.277	0.491	1.302E-9	275	0.059	0.109	4f86A.pdb.gz	Structure analysis of geranyl pyrophosphate methyltransferase and the proposed reaction mechanism of SAM-dependent C-methylation
12	PDB:2pwyA	0.302	0.576	2.195E-9	251	0.061	0.124	2pwyA.pdb.gz	Crystal Structure of Thermus thermophilus tRNA m(1)A(58) Methyltransferase and Biophysical Characterization of Its Interaction with tRNA.
13	AFDB:Q8GBB2	0.314	0.596	3.586E-9	255	0.057	0.114	Q8GBB2.pdb.gz	TRMI_THET2 tRNA (adenine(58)-N(1))-methyltransferase TrmI OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=trmI PE=1 SV=2
14	PDB:3a25A	0.266	0.470	3.925E-9	264	0.073	0.140	3a25A.pdb.gz	Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2
15	PDB:1o9gA	0.252	0.473	4.672E-9	249	0.091	0.185	1o9gA.pdb.gz
16	PDB:1i9gA	0.284	0.521	7.881E-9	264	0.079	0.152	1i9gA.pdb.gz	Crystal structure of Rv2118c: an AdoMet-dependent methyltransferase from Mycobacterium tuberculosis H37Rv.
17	PDB:7wttq	0.270	0.549	8.852E-9	235	0.063	0.136	7wttq.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
18	AFDB:Q18511	0.292	0.638	9.627E-9	214	0.059	0.140	Q18511.pdb.gz	METL5_CAEEL rRNA N6-adenosine-methyltransferase metl-5 OS=Caenorhabditis elegans OX=6239 GN=metl-5 PE=1 SV=1
19	PDB:2bh2A	0.255	0.303	9.943E-9	418	0.069	0.084	2bh2A.pdb.gz	A Unique RNA Fold in the Ruma-RNA-Cofactor Ternary Complex Contributes to Substrate Selectivity and Enzymatic Function
20	AFDB:P9WGA9	0.246	0.312	1.287E-8	390	0.071	0.092	P9WGA9.pdb.gz	COBL_MYCTU Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cobL PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BV44	0.0	1056	507	1.000	1.000	THUM3_HUMAN tRNA (guanine(6)-N2)-methyltransferase THUMP3 OS=Homo sapiens OX=9606 GN=THUMPD3 PE=1 SV=1
2	H7C3J3	3.39e-178	503	269	0.509	0.959	H7C3J3_HUMAN THUMP domain containing 3 (Fragment) OS=Homo sapiens OX=9606 GN=THUMPD3 PE=1 SV=1
3	Q9BTF0	6.99e-34	136	503	0.221	0.223	THUM2_HUMAN THUMP domain-containing protein 2 OS=Homo sapiens OX=9606 GN=THUMPD2 PE=1 SV=2
4	Q57880	5.78e-13	72.8	381	0.148	0.197	TRM14_METJA tRNA (guanine(6)-N2)-methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=trm14 PE=1 SV=1
5	P75864	0.064	38.5	702	0.043	0.031	RLMKL_ECOLI Ribosomal RNA large subunit methyltransferase K/L OS=Escherichia coli (strain K12) OX=83333 GN=rlmL PE=1 SV=1
6	O94636	0.080	38.1	469	0.071	0.077	TRM11_SCHPO tRNA (guanine(10)-N2)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm11 PE=3 SV=2
7	Q9LIN4	0.091	37.7	477	0.061	0.065	Q9LIN4_ARATH Uncharacterized protein At3g26410 OS=Arabidopsis thaliana OX=3702 GN=TRM11 PE=1 SV=1
8	A0A0H2UNG1	0.42	35.4	385	0.045	0.060	A0A0H2UNG1_STRPN THUMP domain-containing protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0373 PE=1 SV=1
9	P0ACC1	1.2	33.9	277	0.041	0.076	PRMC_ECOLI Release factor glutamine methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=prmC PE=1 SV=1
10	Q12463	1.3	33.9	433	0.063	0.074	TRM11_YEAST tRNA (guanine(10)-N2)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM11 PE=1 SV=1
11	P08957	2.5	33.1	529	0.077	0.074	T1MK_ECOLI Type I restriction enzyme EcoKI methylase subunit OS=Escherichia coli (strain K12) OX=83333 GN=hsdM PE=1 SV=1
12	Q54I36	2.9	33.1	1338	0.037	0.014	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
13	Q9U1R1	5.4	31.6	234	0.028	0.060	CEH51_CAEEL Homeobox protein ceh-51 OS=Caenorhabditis elegans OX=6239 GN=ceh-51 PE=2 SV=1
14	Q9LV03	7.9	32.0	2208	0.047	0.011	GLUT1_ARATH Glutamate synthase 1 [NADH], chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLT1 PE=1 SV=2
15	P9WNG5	9.2	31.2	302	0.032	0.053	FABD_MYCTU Malonyl CoA-acyl carrier protein transacylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fabD PE=1 SV=1
16	Q382S8	9.3	31.6	806	0.028	0.017	Q382S8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4370 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11599 AviRa	2.3	19.2	RRNA methyltransferase AviRa
2	PF00142 Fer4_NifH	2e+02	12.9	4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
3	PF13649 Methyltransf_25	0.35	22.9	Methyltransferase domain
4	PF13847 Methyltransf_31	47	15.2	Methyltransferase domain
5	PF05175 MTS	4.9e+02	11.7	Methyltransferase small domain
6	PF02926 THUMP	3.3e-09	48.5	THUMP domain
7	PF01170 UPF0020	2.3e-46	169.5	Putative RNA methylase family UPF0020

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339532

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000438349	0.827	Multifunctional methyltransferase subunit TRM112-like protein
2	9606.ENSP00000385852	0.816	SET domain-containing protein 5
3	9606.ENSP00000351740	0.677	Protein NOXP20
4	9606.ENSP00000322845	0.632	Zinc finger MYM-type protein 3
5	9606.ENSP00000369897	0.626	Cysteine--tRNA ligase, cytoplasmic
6	9606.ENSP00000321455	0.615	Calcium uptake protein 3, mitochondrial
7	9606.ENSP00000349456	0.598	Chloride channel CLIC-like protein 1
8	9606.ENSP00000420682	0.597	Queuine tRNA-ribosyltransferase accessory subunit 2
9	9606.ENSP00000323288	0.562	RNA pseudouridylate synthase domain containing 2
10	9606.ENSP00000373331	0.551	Mitochondrial mRNA pseudouridine synthase RPUSD3
11	9606.ENSP00000380087	0.543	Zinc finger protein 213
12	9606.ENSP00000455026	0.537	RNA pseudouridylate synthase domain containing 1
13	9606.ENSP00000262432	0.533	Methyltransferase-like protein 2B
14	9606.ENSP00000333934	0.527	tRNA (guanine(10)-N2)-methyltransferase homolog
15	9606.ENSP00000370741	0.522	THUMP domain-containing protein 1
16	9606.ENSP00000371201	0.504	Putative methyltransferase NSUN7
17	9606.ENSP00000429608	0.504	FANCD2 opposite strand
18	9606.ENSP00000455229	0.504	tRNA-dihydrouridine(20) synthase [NAD(P)+]-like
19	9606.ENSP00000392511	0.503	Proline rich transmembrane protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008170	1.000	N-methyltransferase activity
GO:0016423	1.000	tRNA (guanine) methyltransferase activity
GO:0004809	0.721	tRNA (guanine-N2-)-methyltransferase activity
GO:0097159	0.463	organic cyclic compound binding
GO:1901363	0.456	heterocyclic compound binding
GO:0003676	0.415	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0006400	0.989	tRNA modification
GO:0001510	0.974	RNA methylation
GO:0030488	0.947	tRNA methylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005730	1.000	nucleolus
GO:0005654	0.305	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.

[back to server]