StarFunc result for job id Q9BV47

User Input

>input (211 residues)
MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACN
HADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHD
SPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIK
KVKDHRGIIPNRGFLRQLLALDRRLRQGLEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BV47	1.000	1.000	1.291E-40	211	1.000	1.000	Q9BV47.pdb.gz	DUS26_HUMAN Dual specificity protein phosphatase 26 OS=Homo sapiens OX=9606 GN=DUSP26 PE=1 SV=1
2	AFDB:Q6B8I0	0.826	0.923	2.061E-23	188	0.464	0.521	Q6B8I0.pdb.gz	DS13A_MOUSE Dual specificity protein phosphatase 13A OS=Mus musculus OX=10090 GN=Dusp13a PE=2 SV=1
3	AFDB:Q68J44	0.809	0.776	3.113E-23	220	0.441	0.423	Q68J44.pdb.gz	DUS29_HUMAN Dual specificity phosphatase 29 OS=Homo sapiens OX=9606 GN=DUSP29 PE=1 SV=1
4	AFDB:Q6B8I1	0.790	0.884	1.935E-22	188	0.464	0.521	Q6B8I1.pdb.gz	DS13A_HUMAN Dual specificity protein phosphatase 13A OS=Homo sapiens OX=9606 GN=DUSP13A PE=1 SV=1
5	AFDB:Q8BK84	0.780	0.766	3.701E-22	215	0.427	0.419	Q8BK84.pdb.gz	DUS29_MOUSE Dual specificity phosphatase 29 OS=Mus musculus OX=10090 GN=Dusp29 PE=1 SV=1
6	AFDB:Q9UII6	0.816	0.868	8.961E-22	198	0.412	0.439	Q9UII6.pdb.gz	DS13B_HUMAN Dual specificity protein phosphatase 13B OS=Homo sapiens OX=9606 GN=DUSP13B PE=1 SV=3
7	PDB:5xjvB	0.753	0.926	4.333E-21	171	0.455	0.561	5xjvB.pdb.gz
8	AFDB:Q9QYJ7	0.812	0.863	2.038E-20	198	0.384	0.409	Q9QYJ7.pdb.gz	DS13B_MOUSE Dual specificity protein phosphatase 13B OS=Mus musculus OX=10090 GN=Dusp13b PE=1 SV=1
9	PDB:2y96A	0.718	0.862	6.522E-20	175	0.422	0.509	2y96A.pdb.gz
10	PDB:2gwoC	0.758	0.916	1.489E-19	174	0.403	0.489	2gwoC.pdb.gz
11	AFDB:A0A0G2K3I9	0.761	0.761	1.598E-18	211	0.346	0.346	A0A0G2K3I9.pdb.gz	A0A0G2K3I9_RAT Dual specificity protein phosphatase OS=Rattus norvegicus OX=10116 GN=Dusp3 PE=1 SV=2
12	AFDB:G3V9L3	0.756	0.828	6.974E-18	192	0.351	0.385	G3V9L3.pdb.gz	G3V9L3_RAT Dual specificity protein phosphatase OS=Rattus norvegicus OX=10116 GN=Dusp3 PE=3 SV=3
13	AFDB:F1QWM2	0.778	0.154	3.425E-17	1100	0.318	0.061	F1QWM2.pdb.gz	STYL2_DANRE Serine/threonine/tyrosine-interacting-like protein 2 OS=Danio rerio OX=7955 GN=styxl2 PE=1 SV=1
14	PDB:3f81A	0.750	0.879	3.794E-17	179	0.341	0.402	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
15	PDB:2wgpA	0.621	0.774	4.461E-13	168	0.270	0.339	2wgpA.pdb.gz
16	PDB:6d66A	0.616	0.259	1.141E-11	517	0.261	0.106	6d66A.pdb.gz
17	PDB:2esbA	0.576	0.743	2.058E-11	162	0.256	0.333	2esbA.pdb.gz
18	PDB:5y15A	0.615	0.858	2.315E-11	148	0.242	0.345	5y15A.pdb.gz
19	PDB:4ercA	0.539	0.732	5.523E-7	150	0.147	0.207	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
20	PDB:2q05A	0.563	0.648	6.992E-7	181	0.190	0.221	2q05A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BV47	1.25e-158	438	211	1.000	1.000	DUS26_HUMAN Dual specificity protein phosphatase 26 OS=Homo sapiens OX=9606 GN=DUSP26 PE=1 SV=1
2	Q9D700	4.02e-154	427	211	0.967	0.967	DUS26_MOUSE Dual specificity protein phosphatase 26 OS=Mus musculus OX=10090 GN=Dusp26 PE=2 SV=2
3	E5RHD0	4.95e-108	308	145	0.687	1.000	E5RHD0_HUMAN Dual specificity protein phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=DUSP26 PE=1 SV=8
4	Q6B8I1	2.11e-64	199	188	0.469	0.527	DS13A_HUMAN Dual specificity protein phosphatase 13A OS=Homo sapiens OX=9606 GN=DUSP13A PE=1 SV=1
5	Q6B8I0	5.06e-63	196	188	0.460	0.516	DS13A_MOUSE Dual specificity protein phosphatase 13A OS=Mus musculus OX=10090 GN=Dusp13a PE=2 SV=1
6	Q68J44	3.98e-56	179	220	0.417	0.400	DUS29_HUMAN Dual specificity phosphatase 29 OS=Homo sapiens OX=9606 GN=DUSP29 PE=1 SV=1
7	Q8BK84	2.35e-54	174	215	0.412	0.405	DUS29_MOUSE Dual specificity phosphatase 29 OS=Mus musculus OX=10090 GN=Dusp29 PE=1 SV=1
8	Q9UII6	7.88e-54	172	198	0.445	0.475	DS13B_HUMAN Dual specificity protein phosphatase 13B OS=Homo sapiens OX=9606 GN=DUSP13B PE=1 SV=3
9	Q9QYJ7	2.51e-50	164	198	0.427	0.455	DS13B_MOUSE Dual specificity protein phosphatase 13B OS=Mus musculus OX=10090 GN=Dusp13b PE=1 SV=1
10	P51452	2.74e-38	132	185	0.346	0.395	DUS3_HUMAN Dual specificity protein phosphatase 3 OS=Homo sapiens OX=9606 GN=DUSP3 PE=1 SV=1
11	Q9D7X3	4.92e-38	132	185	0.346	0.395	DUS3_MOUSE Dual specificity protein phosphatase 3 OS=Mus musculus OX=10090 GN=Dusp3 PE=1 SV=1
12	B5DFF7	6.44e-38	131	185	0.346	0.395	B5DFF7_RAT Dual specificity protein phosphatase OS=Rattus norvegicus OX=10116 GN=Dusp3 PE=2 SV=1
13	G3V9L3	1.13e-37	132	211	0.346	0.346	G3V9L3_RAT Dual specificity protein phosphatase OS=Rattus norvegicus OX=10116 GN=Dusp3 PE=3 SV=3
14	A0A8I6AF61	1.75e-37	131	212	0.346	0.344	A0A8I6AF61_RAT Dual specificity protein phosphatase OS=Rattus norvegicus OX=10116 GN=Dusp3 PE=1 SV=1
15	F1QWM2	4.45e-36	136	1100	0.308	0.059	STYL2_DANRE Serine/threonine/tyrosine-interacting-like protein 2 OS=Danio rerio OX=7955 GN=styxl2 PE=1 SV=1
16	Q9ZR37	1.40e-24	97.8	198	0.280	0.298	DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana OX=3702 GN=DSPTP1 PE=1 SV=1
17	Q05922	6.93e-24	98.6	318	0.280	0.186	DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus OX=10090 GN=Dusp2 PE=1 SV=2
18	O95147	1.75e-23	94.7	198	0.280	0.298	DUS14_HUMAN Dual specificity protein phosphatase 14 OS=Homo sapiens OX=9606 GN=DUSP14 PE=1 SV=1
19	Q05923	3.09e-22	94.0	314	0.275	0.185	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
20	O46122	1.12e-21	94.0	476	0.275	0.122	O46122_DROME Puckered protein OS=Drosophila melanogaster OX=7227 GN=puc PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	1.7e-27	107.3	Dual specificity phosphatase, catalytic domain
2	PF04179 Init_tRNA_PT	22	16.8	Rit1 DUSP-like domain
3	PF00102 Y_phosphatase	2.3	19.3	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000014720

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000003887	0.691	Adenylate kinase 2
2	61853.ENSNLEP00000019179	0.638	Coiled-coil-helix-coiled-coil-helix domain containing 2
3	61853.ENSNLEP00000004492	0.618	ADP-ribosylation factor-like 8B
4	61853.ENSNLEP00000021978	0.618	ADP-ribosylation factor-like 8A
5	61853.ENSNLEP00000005664	0.617	60S ribosomal export protein NMD3
6	61853.ENSNLEP00000008649	0.596	G protein-coupled receptor 1
7	61853.ENSNLEP00000021302	0.596	Proliferation-associated 2G4, 38kDa
8	61853.ENSNLEP00000016417	0.582	G protein-coupled receptor 63
9	61853.ENSNLEP00000017145	0.559	Solute carrier family 30, member 10
10	61853.ENSNLEP00000012447	0.551	Eukaryotic translation initiation factor 6
11	61853.ENSNLEP00000017040	0.536	Methyltransferase like 17
12	61853.ENSNLEP00000008011	0.533	Ribosomal L24 domain containing 1
13	61853.ENSNLEP00000014439	0.526	Zinc finger protein 622
14	61853.ENSNLEP00000011074	0.521	Complement component 1, q subcomponent binding protein
15	61853.ENSNLEP00000014130	0.506	Nucleolar GTP-binding protein 2
16	61853.ENSNLEP00000006113	0.505	NSA2 ribosome biogenesis homolog (S. cerevisiae)
17	61853.ENSNLEP00000008755	0.500	Guanine nucleotide binding protein-like 3 (nucleolar)
18	61853.ENSNLEP00000019697	0.500	Guanine nucleotide binding protein-like 3 (nucleolar)-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008138	1.000	protein tyrosine/serine/threonine phosphatase activity
GO:0008134	0.997	transcription factor binding
GO:0002039	0.991	p53 binding
GO:0140297	0.990	DNA-binding transcription factor binding
GO:0061629	0.821	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0019899	0.307	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0016311	0.993	dephosphorylation
GO:0050794	0.989	regulation of cellular process
GO:0048519	0.974	negative regulation of biological process
GO:0048523	0.935	negative regulation of cellular process
GO:0048583	0.929	regulation of response to stimulus
GO:0071704	0.923	organic substance metabolic process
GO:0010646	0.923	regulation of cell communication
GO:0023051	0.922	regulation of signaling
GO:0009966	0.912	regulation of signal transduction
GO:0044238	0.909	primary metabolic process
GO:1902531	0.902	regulation of intracellular signal transduction
GO:0019538	0.875	protein metabolic process
GO:0019222	0.821	regulation of metabolic process
GO:0043412	0.801	macromolecule modification
GO:0060255	0.779	regulation of macromolecule metabolic process
GO:0009889	0.714	regulation of biosynthetic process
GO:0080090	0.695	regulation of primary metabolic process
GO:0031323	0.693	regulation of cellular metabolic process
GO:0051171	0.678	regulation of nitrogen compound metabolic process
GO:0043408	0.657	regulation of MAPK cascade
GO:0036211	0.636	protein modification process
GO:0010556	0.581	regulation of macromolecule biosynthetic process
GO:0048518	0.538	positive regulation of biological process
GO:0010468	0.508	regulation of gene expression
GO:0048522	0.494	positive regulation of cellular process
GO:0006470	0.494	protein dephosphorylation
GO:0019219	0.470	regulation of nucleobase-containing compound metabolic process
GO:0030155	0.450	regulation of cell adhesion
GO:0031326	0.446	regulation of cellular biosynthetic process
GO:0051252	0.438	regulation of RNA metabolic process
GO:2001141	0.411	regulation of RNA biosynthetic process
GO:1903506	0.403	regulation of nucleic acid-templated transcription
GO:0009892	0.399	negative regulation of metabolic process
GO:0010605	0.382	negative regulation of macromolecule metabolic process
GO:0031324	0.378	negative regulation of cellular metabolic process
GO:0051172	0.376	negative regulation of nitrogen compound metabolic process
GO:0006355	0.367	regulation of DNA-templated transcription
GO:0023057	0.315	negative regulation of signaling
GO:0010648	0.315	negative regulation of cell communication
GO:0009968	0.311	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005654	0.986	nucleoplasm
GO:0016020	0.747	membrane
GO:0012505	0.579	endomembrane system
GO:0031982	0.505	vesicle
GO:0005739	0.367	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.

[back to server]