StarFunc result for job id Q9BV73

User Input

>input (2442 residues)
METRSPGLNNMKPQSLQLVLEEQVLALQQQMAENQAASWRKLKNSQEAQQRQATLVRKLQ
AKVLQYRSWCQELEKRLEATGGPIPQRWENVEEPNLDELLVRLEEEQQRCESLAEVNTQL
RLHMEKADVVNKALREDVEKLTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSL
WREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNGSGRMDG
REPAQLLLLLAKTQELEKEAHERSQELIQLKSQGDLEKAELQDRVTELSALLTQSQKQNE
DYEKMIKALRETVEILETNHTELMEHEASLSRNAQEEKLSLQQVIKDITQVMVEEGDNIA
QGSGHENSLELDSSIFSQFDYQDADKALTLVRSVLTRRRQAVQDLRQQLAGCQEAVNLLQ
QQHDQWEEEGKALRQRLQKLTGERDTLAGQTVDLQGEVDSLSKERELLQKAREELRQQLE
VLEQEAWRLRRVNVELQLQGDSAQGQKEEQQEELHLAVRERERLQEMLMGLEAKQSESLS
ELITLREALESSHLEGELLRQEQTEVTAALARAEQSIAELSSSENTLKTEVADLRAAAVK
LSALNEALALDKVGLNQQLLQLEEENQSVCSRMEAAEQARNALQVDLAEAEKRREALWEK
NTHLEAQLQKAEEAGAELQADLRDIQEEKEEIQKKLSESRHQQEAATTQLEQLHQEAKRQ
EEVLARAVQEKEALVREKAALEVRLQAVERDRQDLAEQLQGLSSAKELLESSLFEAQQQN
SVIEVTKGQLEVQIQTVTQAKEVIQGEVRCLKLELDTERSQAEQERDAAARQLAQAEQEG
KTALEQQKAAHEKEVNQLREKWEKERSWHQQELAKALESLEREKMELEMRLKEQQTEMEA
IQAQREEERTQAESALCQMQLETEKERVSLLETLLQTQKELADASQQLERLRQDMKVQKL
KEQETTGILQTQLQEAQRELKEAARQHRDDLAALQEESSSLLQDKMDLQKQVEDLKSQLV
AQDDSQRLVEQEVQEKLRETQEYNRIQKELEREKASLTLSLMEKEQRLLVLQEADSIRQQ
ELSALRQDMQEAQGEQKELSAQMELLRQEVKEKEADFLAQEAQLLEELEASHITEQQLRA
SLWAQEAKAAQLQLRLRSTESQLEALAAEQQPGNQAQAQAQLASLYSALQQALGSVCESR
PELSGGGDSAPSVWGLEPDQNGARSLFKRGPLLTALSAEAVASALHKLHQDLWKTQQTRD
VLRDQVQKLEERLTDTEAEKSQVHTELQDLQRQLSQNQEEKSKWEGKQNSLESELMELHE
TMASLQSRLRRAELQRMEAQGERELLQAAKENLTAQVEHLQAAVVEARAQASAAGILEED
LRTARSALKLKNEEVESERERAQALQEQGELKVAQGKALQENLALLTQTLAEREEEVETL
RGQIQELEKQREMQKAALELLSLDLKKRNQEVDLQQEQIQELEKCRSVLEHLPMAVQERE
QKLTVQREQIRELEKDRETQRNVLEHQLLELEKKDQMIESQRGQVQDLKKQLVTLECLAL
ELEENHHKMECQQKLIKELEGQRETQRVALTHLTLDLEERSQELQAQSSQIHDLESHSTV
LARELQERDQEVKSQREQIEELQRQKEHLTQDLERRDQELMLQKERIQVLEDQRTRQTKI
LEEDLEQIKLSLRERGRELTTQRQLMQERAEEGKGPSKAQRGSLEHMKLILRDKEKEVEC
QQEHIHELQELKDQLEQQLQGLHRKVGETSLLLSQREQEIVVLQQQLQEAREQGELKEQS
LQSQLDEAQRALAQRDQELEALQQEQQQAQGQEERVKEKADALQGALEQAHMTLKERHGE
LQDHKEQARRLEEELAVEGRRVQALEEVLGDLRAESREQEKALLALQQQCAEQAQEHEVE
TRALQDSWLQAQAVLKERDQELEALRAESQSSRHQEEAARARAEALQEALGKAHAALQGK
EQHLLEQAELSRSLEASTATLQASLDACQAHSRQLEEALRIQEGEIQDQDLRYQEDVQQL
QQALAQRDEELRHQQEREQLLEKSLAQRVQENMIQEKQNLGQEREEEEIRGLHQSVRELQ
LTLAQKEQEILELRETQQRNNLEALPHSHKTSPMEEQSLKLDSLEPRLQRELERLQAALR
QTEAREIEWREKAQDLALSLAQTKASVSSLQEVAMFLQASVLERDSEQQRLQDELELTRR
ALEKERLHSPGATSTAELGSRGEQGVQLGEVSGVEAEPSPDGMEKQSWRQRLEHLQQAVA
RLEIDRSRLQRHNVQLRSTLEQVERERRKLKREAMRAAQAGSLEISKATASSPTQQDGRG
QKNSDAKCVAELQKEVVLLQAQLTLERKQKQDYITRSAQTSRELAGLHHSLSHSLLAVAQ
APEATVLEAETRRLDESLTQSLTSPGPVLLHPSPSTTQAASR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q60952	0.086	0.087	0.000	2414	0.785	0.795	Q60952.pdb.gz	CP250_MOUSE Centrosome-associated protein CEP250 OS=Mus musculus OX=10090 GN=Cep250 PE=1 SV=4
2	AFDB:Q9BV73	1.000	1.000	0.000	2442	1.000	1.000	Q9BV73.pdb.gz	CP250_HUMAN Centrosome-associated protein CEP250 OS=Homo sapiens OX=9606 GN=CEP250 PE=1 SV=2
3	AFDB:Q8CJ40	0.071	0.081	4.762E-16	2009	0.208	0.253	Q8CJ40.pdb.gz	CROCC_MOUSE Rootletin OS=Mus musculus OX=10090 GN=Crocc PE=1 SV=2
4	AFDB:Q5TZA2	0.061	0.071	1.325E-15	2017	0.226	0.274	Q5TZA2.pdb.gz	CROCC_HUMAN Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=2
5	AFDB:E7F2T0	0.052	0.060	1.986E-11	1959	0.194	0.241	E7F2T0.pdb.gz	E7F2T0_DANRE Ciliary rootlet coiled-coil, rootletin family member 2 OS=Danio rerio OX=7955 GN=crocc2 PE=4 SV=1
6	AFDB:Q9VCD1	0.069	0.080	2.553E-6	2048	0.192	0.229	Q9VCD1.pdb.gz	Q9VCD1_DROME Rootletin, isoform D OS=Drosophila melanogaster OX=7227 GN=Root PE=4 SV=3
7	AFDB:Q6RT24	0.047	0.050	4.029E-2	2474	0.165	0.162	Q6RT24.pdb.gz	CENPE_MOUSE Centromere-associated protein E OS=Mus musculus OX=10090 GN=Cenpe PE=1 SV=1
8	AFDB:A2AUM9	0.040	0.053	2.179E-1	1736	0.103	0.145	A2AUM9.pdb.gz	CE152_MOUSE Centrosomal protein of 152 kDa OS=Mus musculus OX=10090 GN=Cep152 PE=1 SV=1
9	AFDB:Q2TAC2	0.036	0.081	2.293E-1	915	0.064	0.172	Q2TAC2.pdb.gz	CCD57_HUMAN Coiled-coil domain-containing protein 57 OS=Homo sapiens OX=9606 GN=CCDC57 PE=1 SV=3
10	AFDB:Q38BI3	0.047	0.046	3.634E-1	2539	0.165	0.159	Q38BI3.pdb.gz	Q38BI3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3090 PE=4 SV=1
11	PDB:4h63H	0.016	0.122	9.528	174	0.006	0.086	4h63H.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H7C0P0	0.0	1637	877	0.359	1.000	H7C0P0_HUMAN Centrosomal protein 250 (Fragment) OS=Homo sapiens OX=9606 GN=CEP250 PE=1 SV=1
2	Q60952	0.0	3380	2414	0.787	0.796	CP250_MOUSE Centrosome-associated protein CEP250 OS=Mus musculus OX=10090 GN=Cep250 PE=1 SV=4
3	Q9BV73	0.0	4661	2442	1.000	1.000	CP250_HUMAN Centrosome-associated protein CEP250 OS=Homo sapiens OX=9606 GN=CEP250 PE=1 SV=2
4	Q5TZA2	2.24e-120	428	2017	0.194	0.235	CROCC_HUMAN Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=2
5	B1AKD8	6.04e-98	350	1311	0.164	0.305	B1AKD8_HUMAN Ciliary rootlet coiled-coil, rootletin (Fragment) OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=2
6	Q8CJ40	1.68e-84	312	2009	0.176	0.214	CROCC_MOUSE Rootletin OS=Mus musculus OX=10090 GN=Crocc PE=1 SV=2
7	A0A087WW81	2.96e-80	287	838	0.109	0.317	A0A087WW81_HUMAN Ciliary rootlet coiled-coil, rootletin (Fragment) OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=6
8	E7F2T0	2.67e-69	262	1959	0.144	0.180	E7F2T0_DANRE Ciliary rootlet coiled-coil, rootletin family member 2 OS=Danio rerio OX=7955 GN=crocc2 PE=4 SV=1
9	Q9VCD1	2.15e-34	148	2048	0.112	0.133	Q9VCD1_DROME Rootletin, isoform D OS=Drosophila melanogaster OX=7227 GN=Root PE=4 SV=3
10	Q09EF7	1.42e-05	53.1	1955	0.014	0.017	CROCC_CAEEL Rootletin OS=Caenorhabditis elegans OX=6239 GN=che-10 PE=2 SV=2
11	Q8MSN3	9.58e-05	50.4	1230	0.012	0.024	Q8MSN3_DROME AT16851p OS=Drosophila melanogaster OX=7227 GN=Root PE=2 SV=1
12	Q57UV7	0.004	45.4	1456	0.055	0.093	Q57UV7_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.660 PE=3 SV=1
13	H2L0I2	0.034	42.4	2396	0.014	0.014	H2L0I2_CAEEL Lin-5 (Five) Interacting protein OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=1
14	H2L0I3	0.035	42.0	2323	0.014	0.014	H2L0I3_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
15	H2L0I4	0.038	42.0	2392	0.014	0.014	H2L0I4_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
16	O01583	0.079	40.8	1592	0.027	0.041	MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans OX=6239 GN=mrck-1 PE=1 SV=3
17	Q381P0	0.44	38.5	2293	0.034	0.036	Q381P0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7095 PE=3 SV=1
18	Q57UD0	0.49	38.5	1803	0.047	0.064	Q57UD0_TRYB2 Kinesin K39, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.6C8.180 PE=3 SV=1
19	Q382P4	0.65	37.7	1299	0.042	0.079	Q382P4_TRYB2 IF rod domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0008 PE=4 SV=1
20	P40457	0.78	37.7	1679	0.017	0.025	MLP2_YEAST Protein MLP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MLP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15035 Rootletin	4.1e-55	198.3	Ciliary rootlet component, centrosome cohesion

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380661

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383003	0.884	Peptidyl-prolyl cis-trans isomerase FKBP1A
2	9606.ENSP00000355966	0.798	Serine/threonine-protein kinase Nek2
3	9606.ENSP00000370021	0.794	Centlein
4	9606.ENSP00000257287	0.754	Centrosomal protein of 135 kDa
5	9606.ENSP00000362962	0.738	Centriolin
6	9606.ENSP00000306760	0.721	Leucine-rich repeat-containing protein 45
7	9606.ENSP00000371472	0.721	Ninein
8	9606.ENSP00000365782	0.717	Centrosomal protein of 78 kDa
9	9606.ENSP00000352572	0.646	Pericentrin
10	9606.ENSP00000355500	0.643	Centrosomal protein of 170 kDa
11	9606.ENSP00000332809	0.635	Uncharacterized protein C2orf71
12	9606.ENSP00000480489	0.616	PDZ domain-containing protein 7
13	9606.ENSP00000480279	0.606	Usher syndrome type-1G protein
14	9606.ENSP00000329158	0.600	Clarin-1
15	9606.ENSP00000258930	0.598	Calcium and integrin-binding family member 2
16	9606.ENSP00000278886	0.590	Ninein-like protein
17	9606.ENSP00000363506	0.590	Ubiquinol-cytochrome-c reductase complex assembly factor 1
18	9606.ENSP00000263710	0.586	CLIP-associating protein 1
19	9606.ENSP00000327077	0.580	Pericentriolar material 1 protein
20	9606.ENSP00000372857	0.577	Serine/threonine-protein kinase Nek11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	1.000	protein domain specific binding
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0016043	0.976	cellular component organization
GO:0006996	0.965	organelle organization
GO:0007098	0.940	centrosome cycle
GO:0070925	0.905	organelle assembly
GO:0048522	0.867	positive regulation of cellular process
GO:0051179	0.835	localization
GO:0050896	0.835	response to stimulus
GO:0008104	0.757	protein localization
GO:0033365	0.655	protein localization to organelle
GO:0032879	0.588	regulation of localization
GO:0030030	0.518	cell projection organization
GO:0044380	0.505	protein localization to cytoskeleton
GO:0032501	0.498	multicellular organismal process
GO:0051726	0.477	regulation of cell cycle
GO:0120036	0.439	plasma membrane bounded cell projection organization
GO:0000278	0.428	mitotic cell cycle
GO:0051606	0.412	detection of stimulus
GO:0060341	0.394	regulation of cellular localization
GO:0044782	0.374	cilium organization
GO:0010564	0.345	regulation of cell cycle process
GO:1905508	0.308	protein localization to microtubule organizing center
GO:1903829	0.300	positive regulation of protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005814	0.999	centriole
GO:0005813	0.999	centrosome
GO:0043227	0.998	membrane-bounded organelle
GO:0005829	0.980	cytosol
GO:0005576	0.909	extracellular region
GO:0043231	0.812	intracellular membrane-bounded organelle
GO:0120025	0.810	plasma membrane bounded cell projection
GO:0005929	0.724	cilium
GO:0005615	0.702	extracellular space
GO:0032991	0.684	protein-containing complex
GO:0065010	0.651	extracellular membrane-bounded organelle
GO:0070062	0.642	extracellular exosome
GO:0012505	0.414	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]