StarFunc result for job id Q9BV79

User Input

>input (373 residues)
MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGDPAKVVEL
KNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVT
GLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQ
LQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEE
ELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLL
IFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEAS
MKPFISSKQILTM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BV79	1.000	1.000	2.030E-82	373	1.000	1.000	Q9BV79.pdb.gz	MECR_HUMAN Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Homo sapiens OX=9606 GN=MECR PE=1 SV=2
2	AFDB:Q9DCS3	0.932	0.932	2.480E-74	373	0.818	0.818	Q9DCS3.pdb.gz	MECR_MOUSE Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Mus musculus OX=10090 GN=Mecr PE=1 SV=2
3	AFDB:Q7YS70	0.938	0.938	3.362E-74	373	0.845	0.845	Q7YS70.pdb.gz	MECR_BOVIN Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Bos taurus OX=9913 GN=MECR PE=1 SV=1
4	PDB:1zsyA	0.893	0.959	1.120E-69	347	0.893	0.960	1zsyA.pdb.gz
5	AFDB:Q28GQ2	0.883	0.940	1.413E-57	350	0.571	0.609	Q28GQ2.pdb.gz	MECR_XENTR Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Xenopus tropicalis OX=8364 GN=mecr PE=2 SV=1
6	AFDB:Q8LCU7	0.868	0.864	1.988E-47	375	0.418	0.416	Q8LCU7.pdb.gz	MECR_ARATH Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g45770 PE=1 SV=1
7	AFDB:Q10488	0.856	0.858	1.159E-40	372	0.383	0.384	Q10488.pdb.gz	ETR1_SCHPO Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=etr1 PE=3 SV=1
8	AFDB:Q8WZM3	0.831	0.804	9.752E-40	386	0.365	0.352	Q8WZM3.pdb.gz	ETR1_CANTR Enoyl-[acyl-carrier-protein] reductase 1, mitochondrial OS=Candida tropicalis OX=5482 GN=ETR1 PE=1 SV=1
9	PDB:5lb9A	0.820	0.837	1.253E-39	365	0.349	0.356	5lb9A.pdb.gz	A conserved threonine prevents self-intoxication of enoyl-thioester reductases.
10	AFDB:P38071	0.826	0.811	4.327E-36	380	0.332	0.326	P38071.pdb.gz	ETR1_YEAST Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ETR1 PE=1 SV=3
11	AFDB:Q38EM5	0.822	0.695	2.603E-32	445	0.265	0.222	Q38EM5.pdb.gz	Q38EM5_TRYB2 Oxidoreductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5260 PE=4 SV=1
12	AFDB:A1L4Y4	0.781	0.721	3.634E-29	406	0.252	0.232	A1L4Y4.pdb.gz	A1L4Y4_ARATH At5g61510 OS=Arabidopsis thaliana OX=3702 GN=At5g61510 PE=1 SV=1
13	PDB:1yb5A	0.765	0.871	4.007E-26	324	0.193	0.222	1yb5A.pdb.gz	Crystal Structure of human Zeta-Crystallin at 1.85A
14	PDB:3qwaB	0.756	0.842	4.526E-26	332	0.193	0.217	3qwaB.pdb.gz
15	PDB:6k9yA	0.742	0.804	8.317E-26	342	0.233	0.254	6k9yA.pdb.gz
16	PDB:5a3jC	0.714	0.807	7.903E-25	327	0.190	0.217	5a3jC.pdb.gz	Crystal Structure of the Chloroplastic Oxoene Reductase ceQORH from Arabidopsis thaliana.
17	PDB:1qorA	0.755	0.856	4.087E-24	326	0.217	0.248	1qorA.pdb.gz	Crystal structure of Escherichia coli QOR quinone oxidoreductase complexed with NADPH.
18	PDB:5envA	0.745	0.796	1.871E-23	347	0.177	0.190	5envA.pdb.gz	Mechanistic implications from structures of yeast alcohol dehydrogenase complexed with coenzyme and an alcohol.
19	PDB:2obyA	0.729	0.805	2.865E-23	334	0.212	0.237	2obyA.pdb.gz	Crystal structure of human P53 inducible oxidoreductase (TP53I3, PIG3)
20	PDB:2dm6B	0.694	0.768	9.104E-23	333	0.190	0.213	2dm6B.pdb.gz	Crystal structure of anti-configuration of indomethacin and leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase complex reveals the structural basis of broad spectrum indomethacin efficacy

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7YS70	0.0	630	373	0.845	0.845	MECR_BOVIN Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Bos taurus OX=9913 GN=MECR PE=1 SV=1
2	Q9BV79	0.0	766	373	1.000	1.000	MECR_HUMAN Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Homo sapiens OX=9606 GN=MECR PE=1 SV=2
3	Q9DCS3	0.0	622	373	0.818	0.818	MECR_MOUSE Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Mus musculus OX=10090 GN=Mecr PE=1 SV=2
4	Q9Z311	0.0	613	373	0.812	0.812	MECR_RAT Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mecr PE=1 SV=1
5	Q28GQ2	9.22e-152	433	350	0.571	0.609	MECR_XENTR Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Xenopus tropicalis OX=8364 GN=mecr PE=2 SV=1
6	Q8LCU7	4.80e-98	298	375	0.421	0.419	MECR_ARATH Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g45770 PE=1 SV=1
7	Q10488	6.32e-80	251	372	0.386	0.387	ETR1_SCHPO Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=etr1 PE=3 SV=1
8	Q8WZM4	1.44e-68	222	386	0.357	0.345	ETR2_CANTR Enoyl-[acyl-carrier-protein] reductase 2, mitochondrial OS=Candida tropicalis OX=5482 GN=ETR2 PE=1 SV=1
9	Q8WZM3	2.87e-68	221	386	0.354	0.342	ETR1_CANTR Enoyl-[acyl-carrier-protein] reductase 1, mitochondrial OS=Candida tropicalis OX=5482 GN=ETR1 PE=1 SV=1
10	P38071	5.37e-57	192	380	0.324	0.318	ETR1_YEAST Enoyl-[acyl-carrier-protein] reductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ETR1 PE=1 SV=3
11	Q38EM5	5.22e-25	107	445	0.244	0.204	Q38EM5_TRYB2 Oxidoreductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5260 PE=4 SV=1
12	P95185	6.54e-18	85.9	323	0.206	0.238	P95185_MYCTU Probable NADPH quinone oxidoreductase FadB4 (NADPH:quinone reductase) (Zeta-crystallin) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadB4 PE=1 SV=1
13	P96291	1.87e-17	86.7	2111	0.228	0.040	P96291_MYCTO Mycocerosic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=mas-2 PE=4 SV=2
14	Q99536	3.10e-17	84.7	393	0.182	0.173	VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 PE=1 SV=2
15	A1L4Y4	4.67e-17	84.3	406	0.233	0.214	A1L4Y4_ARATH At5g61510 OS=Arabidopsis thaliana OX=3702 GN=At5g61510 PE=1 SV=1
16	P96202	3.25e-15	79.7	2188	0.206	0.035	PPSC_MYCTU Phenolphthiocerol/phthiocerol polyketide synthase subunit C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ppsC PE=1 SV=2
17	Q7TXL8	3.25e-15	79.7	2188	0.206	0.035	PPSC_MYCBO Phenolphthiocerol/phthiocerol polyketide synthase subunit C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=ppsC PE=1 SV=1
18	Q57TX8	4.98e-15	77.4	335	0.236	0.263	Q57TX8_TRYB2 Oxidoreductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.30D13.370 PE=4 SV=1
19	Q9LK96	7.60e-15	77.4	366	0.249	0.254	Q9LK96_ARATH AT3g15090/K15M2_24 OS=Arabidopsis thaliana OX=3702 GN=At3g15090 PE=1 SV=1
20	Q9UAT1	7.95e-15	77.0	350	0.204	0.217	Q9UAT1_CAEEL Enoyl reductase (ER) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_D2063.1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08240 ADH_N	5.4e-05	34.4	Alcohol dehydrogenase GroES-like domain
2	PF00107 ADH_zinc_N	1.4e-16	72.1	Zinc-binding dehydrogenase
3	PF13602 ADH_zinc_N_2	0.019	27.4	Zinc-binding dehydrogenase
4	PF00291 PALP	13	16.7	Pyridoxal-phosphate dependent enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263702

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280701	0.966	3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial
2	9606.ENSP00000357535	0.953	Enoyl-CoA hydratase, mitochondrial
3	9606.ENSP00000285093	0.935	3-ketoacyl-CoA thiolase, mitochondrial
4	9606.ENSP00000370023	0.933	Trifunctional enzyme subunit alpha, mitochondrial
5	9606.ENSP00000325136	0.930	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
6	9606.ENSP00000394863	0.925	Palmitoyl-protein thioesterase 1
7	9606.ENSP00000304592	0.915	Fatty acid synthase
8	9606.ENSP00000481593	0.914	Hydroxyacyl-thioester dehydratase type 2, mitochondrial
9	9606.ENSP00000354608	0.905	Lysosomal thioesterase PPT2
10	9606.ENSP00000358059	0.886	Reticulon-4-interacting protein 1, mitochondrial
11	9606.ENSP00000348775	0.883	Peroxisomal acyl-coenzyme A oxidase 3
12	9606.ENSP00000325562	0.869	MICOS complex subunit MIC10
13	9606.ENSP00000357873	0.850	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
14	9606.ENSP00000242592	0.836	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
15	9606.ENSP00000293217	0.834	Peroxisomal acyl-coenzyme A oxidase 1
16	9606.ENSP00000309463	0.826	Putative lipoyltransferase 2, mitochondrial
17	9606.ENSP00000233710	0.821	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
18	9606.ENSP00000438689	0.816	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
19	9606.ENSP00000264029	0.815	Trehalase
20	9606.ENSP00000377115	0.801	Lipoyltransferase 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016628	0.997	oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
GO:0005488	0.993	binding
GO:0097159	0.691	organic cyclic compound binding
GO:1901363	0.690	heterocyclic compound binding
GO:0005515	0.680	protein binding
GO:0016616	0.608	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0043167	0.542	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006629	0.990	lipid metabolic process
GO:0044255	0.984	cellular lipid metabolic process
GO:0006631	0.967	fatty acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0005759	0.910	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.3.1.-	0.997	With NAD(+) or NADP(+) as acceptor.
EC:1.1.1.-	0.608	With NAD(+) or NADP(+) as acceptor.

[back to server]