StarFunc result for job id Q9BV81

User Input

>input (110 residues)
MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASV
LLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BV81	1.000	1.000	1.641E-15	110	1.000	1.000	Q9BV81.pdb.gz	EMC6_HUMAN ER membrane protein complex subunit 6 OS=Homo sapiens OX=9606 GN=EMC6 PE=1 SV=1
2	PDB:6z3wF	0.762	0.762	2.881E-9	110	1.000	1.000	6z3wF.pdb.gz
3	AFDB:Q9VBZ8	0.816	0.795	1.097E-7	113	0.500	0.487	Q9VBZ8.pdb.gz	Q9VBZ8_DROME ER membrane protein complex subunit 6 OS=Drosophila melanogaster OX=7227 GN=EMC6 PE=1 SV=1
4	AFDB:O59764	0.835	0.849	3.164E-4	108	0.318	0.324	O59764.pdb.gz	YJMB_SCHPO ER membrane protein complex subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1020.11c PE=3 SV=2
5	AFDB:Q380Y6	0.784	0.805	6.558E-4	107	0.245	0.252	Q380Y6.pdb.gz	Q380Y6_TRYB2 ER membrane protein complex subunit 6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8775 PE=3 SV=1
6	AFDB:Q12431	0.725	0.737	9.835E-3	108	0.209	0.213	Q12431.pdb.gz	EMC6_YEAST ER membrane protein complex subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EMC6 PE=1 SV=1
7	PDB:6wb96	0.673	0.748	1.501E-2	98	0.218	0.245	6wb96.pdb.gz
8	AFDB:Q9BUV8	0.503	0.416	8.224E-1	137	0.155	0.124	Q9BUV8.pdb.gz	RCAF1_HUMAN GEL complex subunit OPTI OS=Homo sapiens OX=9606 GN=RAB5IF PE=1 SV=1
9	PDB:1l7vA	0.272	0.128	2.345	324	0.173	0.059	1l7vA.pdb.gz	The E. coli BtuCD structure: a framework for ABC transporter architecture and mechanism.
10	PDB:4cadI	0.286	0.139	2.602	254	0.100	0.043	4cadI.pdb.gz
11	AFDB:Q91WU6	0.268	0.128	3.023	308	0.118	0.042	Q91WU6.pdb.gz	ZDHC7_MOUSE Palmitoyltransferase ZDHHC7 OS=Mus musculus OX=10090 GN=Zdhhc7 PE=1 SV=1
12	PDB:7xk7D	0.477	0.293	3.746	206	0.118	0.063	7xk7D.pdb.gz	Cryo-EM structures of Na + -pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae.
13	AFDB:O31652	0.204	0.096	3.923	320	0.127	0.044	O31652.pdb.gz	COXX1_BACSU Protoheme IX farnesyltransferase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=ctaB1 PE=1 SV=3
14	AFDB:Q0WUA3	0.246	0.101	4.132	382	0.227	0.065	Q0WUA3.pdb.gz	MENA_ARATH 2-carboxy-1,4-naphthoquinone phytyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC4 PE=1 SV=2
15	AFDB:Q9VYX8	0.211	0.162	4.132	160	0.191	0.131	Q9VYX8.pdb.gz	Q9VYX8_DROME LD04844p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1572 PE=1 SV=1
16	PDB:7aqqf	0.207	0.222	5.986	101	0.173	0.188	7aqqf.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
17	PDB:6wlwT	0.221	0.254	7.372	85	0.182	0.235	6wlwT.pdb.gz	Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.
18	PDB:3ucaA	0.232	0.125	9.079	274	0.136	0.055	3ucaA.pdb.gz
19	PDB:4oh3B	0.250	0.078	9.565	537	0.109	0.022	4oh3B.pdb.gz
20	PDB:5mkkB	0.257	0.073	9.565	577	0.127	0.024	5mkkB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BV81	3.86e-74	216	110	1.000	1.000	EMC6_HUMAN ER membrane protein complex subunit 6 OS=Homo sapiens OX=9606 GN=EMC6 PE=1 SV=1
2	Q9VBZ8	8.92e-36	120	113	0.500	0.487	Q9VBZ8_DROME ER membrane protein complex subunit 6 OS=Drosophila melanogaster OX=7227 GN=EMC6 PE=1 SV=1
3	O59764	4.41e-09	52.0	108	0.318	0.324	YJMB_SCHPO ER membrane protein complex subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1020.11c PE=3 SV=2
4	Q380Y6	6.35e-05	41.2	107	0.255	0.262	Q380Y6_TRYB2 ER membrane protein complex subunit 6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8775 PE=3 SV=1
5	Q9LV11	1.5	30.0	956	0.136	0.016	PMA11_ARATH ATPase 11, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=AHA11 PE=1 SV=1
6	Q8WY21	6.3	28.5	1168	0.109	0.010	SORC1_HUMAN VPS10 domain-containing receptor SorCS1 OS=Homo sapiens OX=9606 GN=SORCS1 PE=1 SV=3
7	Q9JLC4	6.3	28.5	1167	0.109	0.010	SORC1_MOUSE VPS10 domain-containing receptor SorCS1 OS=Mus musculus OX=10090 GN=Sorcs1 PE=1 SV=1
8	Q13443	7.9	28.1	819	0.082	0.011	ADAM9_HUMAN Disintegrin and metalloproteinase domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ADAM9 PE=1 SV=1
9	Q08682	8.1	27.7	298	0.182	0.067	RSSA1_ARATH Small ribosomal subunit protein uS2z OS=Arabidopsis thaliana OX=3702 GN=RPSaA PE=1 SV=3
10	Q9SU58	8.9	27.7	960	0.136	0.016	PMA4_ARATH ATPase 4, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=AHA4 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07019 EMC6	5.2e-20	83.1	EMC6
2	PF15872 SRTM1	70	15.0	Serine-rich and transmembrane domain-containing protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008853840.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008838911.1	0.999	Membrane magnesium transporter 1
2	1026970.XP_008839361.1	0.999	ER membrane protein complex subunit 4 isoform X1
3	1026970.XP_008843453.1	0.999	ER membrane protein complex subunit 10
4	1026970.XP_008849724.1	0.999	ER membrane protein complex subunit 2 isoform X1
5	1026970.XP_008839369.1	0.998	ER membrane protein complex subunit 7
6	1026970.XP_008853087.1	0.998	ER membrane protein complex subunit 3
7	1026970.XP_008838054.1	0.996	ER membrane protein complex subunit 9
8	1026970.XP_008820048.1	0.992	ER membrane protein complex subunit 1
9	1026970.XP_008826113.1	0.992	ER membrane protein complex subunit 8
10	1026970.XP_008823429.1	0.699	Translocation associated membrane protein 2
11	1026970.XP_008837141.1	0.697	39S ribosomal protein L55, mitochondrial isoform X1
12	1026970.XP_008850737.1	0.692	39S ribosomal protein L36, mitochondrial
13	1026970.XP_008850025.1	0.682	Signal peptidase complex subunit 1
14	1026970.XP_008854084.1	0.641	Asialoglycoprotein receptor 1
15	1026970.XP_008834824.1	0.640	28S ribosomal protein S16, mitochondrial isoform X1
16	1026970.XP_008837431.1	0.624	Mitochondrial ribosomal protein L23
17	1026970.XP_008839439.1	0.605	Guanine nucleotide-binding protein-like 1
18	1026970.XP_008843164.1	0.543	UBX domain-containing protein 8 isoform X1
19	1026970.XP_008845823.1	0.540	ER lipid raft associated 2
20	1026970.XP_008843530.1	0.536	StAR related lipid transfer domain containing 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032977	1.000	membrane insertase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0008152	0.977	metabolic process
GO:0044237	0.941	cellular metabolic process
GO:0071840	0.935	cellular component organization or biogenesis
GO:0006996	0.925	organelle organization
GO:0070925	0.916	organelle assembly
GO:1905037	0.916	autophagosome organization
GO:0000045	0.914	autophagosome assembly
GO:0051234	0.913	establishment of localization
GO:0051641	0.879	cellular localization
GO:0033036	0.874	macromolecule localization
GO:0007029	0.874	endoplasmic reticulum organization
GO:0045048	0.855	protein insertion into ER membrane
GO:0071816	0.365	tail-anchored membrane protein insertion into ER membrane
GO:0045050	0.346	protein insertion into ER membrane by stop-transfer membrane-anchor sequence

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.997	endoplasmic reticulum membrane
GO:0098796	0.996	membrane protein complex
GO:0072546	0.992	EMC complex
GO:0098588	0.986	bounding membrane of organelle
GO:1903349	0.661	omegasome membrane
GO:0005739	0.612	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]