StarFunc result for job id Q9BV86

User Input

>input (223 residues)
MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKT
GTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQ
DFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVD
SSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFALR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R8E4	0.999	0.999	1.873E-48	223	1.000	1.000	A0A024R8E4.pdb.gz
2	PDB:6dtnB	0.981	0.940	2.357E-45	233	0.991	0.948	6dtnB.pdb.gz	Discovery of Bisubstrate Inhibitors for Protein N-Terminal Methyltransferase 1.
3	AFDB:Q5VVY1	0.930	0.735	1.062E-31	283	0.484	0.382	Q5VVY1.pdb.gz	NTM1B_HUMAN N-terminal Xaa-Pro-Lys N-methyltransferase 2 OS=Homo sapiens OX=9606 GN=NTMT2 PE=1 SV=2
4	AFDB:Q6NN40	0.897	0.727	9.847E-29	276	0.404	0.326	Q6NN40.pdb.gz	NTM1_DROME Alpha N-terminal protein methyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=Ntmt PE=1 SV=1
5	AFDB:O13748	0.909	0.925	1.248E-27	219	0.377	0.384	O13748.pdb.gz	NTM1_SCHPO Alpha N-terminal protein methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tae1 PE=3 SV=1
6	AFDB:Q584S3	0.903	0.808	2.909E-27	250	0.395	0.352	Q584S3.pdb.gz	Q584S3_TRYB2 RGG protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.660 PE=3 SV=1
7	PDB:7d8fA	0.899	0.858	4.193E-27	234	0.381	0.363	7d8fA.pdb.gz	Structural Basis for Peptide Binding of Alpha-N Terminal Methyltransferase from Saccharomyces cerevisiae
8	AFDB:P38340	0.897	0.864	8.052E-25	232	0.381	0.366	P38340.pdb.gz	NTM1_YEAST Alpha N-terminal protein methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAE1 PE=1 SV=1
9	AFDB:A0A1D8PQL1	0.886	0.816	9.042E-24	243	0.363	0.333	A0A1D8PQL1.pdb.gz	A0A1D8PQL1_CANAL N-terminal protein methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C700490CA PE=3 SV=1
10	PDB:5wp5A	0.632	0.317	4.958E-12	463	0.161	0.078	5wp5A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
11	AFDB:Q8TCB7	0.675	0.549	7.108E-12	284	0.148	0.116	Q8TCB7.pdb.gz	METL6_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL6 OS=Homo sapiens OX=9606 GN=METTL6 PE=1 SV=2
12	AFDB:Q6P1Q9	0.569	0.355	8.522E-12	378	0.148	0.087	Q6P1Q9.pdb.gz	MET2B_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL2B OS=Homo sapiens OX=9606 GN=METTL2B PE=1 SV=3
13	AFDB:O74386	0.671	0.610	9.053E-12	248	0.139	0.125	O74386.pdb.gz	TR141_SCHPO tRNA N(3)-methylcytidine methyltransferase trm141 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm141 PE=1 SV=1
14	PDB:5wp4A	0.700	0.342	3.042E-11	485	0.175	0.080	5wp4A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
15	PDB:7ezgA	0.656	0.545	6.284E-11	275	0.148	0.120	7ezgA.pdb.gz	Crystal structure of human METTL6, the m 3 C methyltransferase.
16	PDB:2ip2A	0.659	0.464	8.502E-11	330	0.188	0.127	2ip2A.pdb.gz
17	PDB:3gwzA	0.580	0.401	1.556E-10	339	0.166	0.109	3gwzA.pdb.gz	Structural characterization of the mitomycin 7-O-methyltransferase.
18	PDB:6orrC	0.640	0.535	3.215E-10	273	0.143	0.117	6orrC.pdb.gz	High-Affinity Alkynyl Bisubstrate Inhibitors of NicotinamideN-Methyltransferase (NNMT).
19	PDB:1tw2B	0.594	0.398	3.855E-10	350	0.184	0.117	1tw2B.pdb.gz	Crystal structure of a ternary complex of DnrK, a methyltransferase in daunorubicin biosynthesis, with bound products
20	PDB:2an3B	0.607	0.515	5.541E-10	269	0.135	0.112	2an3B.pdb.gz	Mode of binding of methyl acceptor substrates to the adrenaline-synthesizing enzyme phenylethanolamine N-methyltransferase: implications for catalysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BV86	1.22e-167	462	223	1.000	1.000	NTM1A_HUMAN N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=NTMT1 PE=1 SV=3
2	Q8R2U4	2.69e-158	438	223	0.942	0.942	NTM1A_MOUSE N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Mus musculus OX=10090 GN=Ntmt1 PE=1 SV=3
3	S4R338	3.19e-97	281	135	0.605	1.000	S4R338_HUMAN N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=NTMT1 PE=1 SV=1
4	Q5VVY1	1.02e-81	247	283	0.507	0.399	NTM1B_HUMAN N-terminal Xaa-Pro-Lys N-methyltransferase 2 OS=Homo sapiens OX=9606 GN=NTMT2 PE=1 SV=2
5	Q6NN40	7.05e-54	176	276	0.417	0.337	NTM1_DROME Alpha N-terminal protein methyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=Ntmt PE=1 SV=1
6	O13748	9.44e-47	155	219	0.381	0.388	NTM1_SCHPO Alpha N-terminal protein methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tae1 PE=3 SV=1
7	P38340	1.49e-43	148	232	0.390	0.375	NTM1_YEAST Alpha N-terminal protein methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAE1 PE=1 SV=1
8	Q584S3	1.88e-43	148	250	0.386	0.344	Q584S3_TRYB2 RGG protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.660 PE=3 SV=1
9	A0A1D8PQL1	2.21e-41	142	243	0.390	0.358	A0A1D8PQL1_CANAL N-terminal protein methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C700490CA PE=3 SV=1
10	S4R3J7	3.10e-34	120	109	0.265	0.541	S4R3J7_HUMAN N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=NTMT1 PE=1 SV=1
11	Q23552	3.23e-05	46.6	475	0.139	0.065	PMT1_CAEEL Phosphoethanolamine N-methyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=pmt-1 PE=1 SV=2
12	Q944H0	0.019	38.1	491	0.139	0.063	PEAM2_ARATH Phosphoethanolamine N-methyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=NMT2 PE=1 SV=2
13	A0A4P8DY91	0.023	37.7	364	0.130	0.080	COMTS_KITPR Esculetin O-methyltransferase OS=Kitagawia praeruptora OX=312531 GN=COMT-S PE=1 SV=1
14	P28002	0.027	37.4	365	0.143	0.088	COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa OX=3879 PE=1 SV=1
15	Q54527	0.031	37.4	374	0.152	0.091	RDMB_STREF Aclacinomycin 10-hydroxylase RdmB OS=Streptomyces purpurascens OX=1924 GN=rdmB PE=1 SV=1
16	Q9FK25	0.042	37.0	363	0.143	0.088	OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=OMT1 PE=1 SV=1
17	D3KU66	0.044	37.0	387	0.152	0.088	ASMT_MOUSE Acetylserotonin O-methyltransferase OS=Mus musculus OX=10090 GN=Asmt PE=1 SV=1
18	Q22993	0.047	37.0	437	0.148	0.076	PMT2_CAEEL Phosphoethanolamine N-methyltransferase 2 OS=Caenorhabditis elegans OX=6239 GN=pmt-2 PE=1 SV=1
19	Q7U4Z9	0.051	36.6	280	0.202	0.161	SDMT_PARMW Dimethylglycine N-methyltransferase OS=Parasynechococcus marenigrum (strain WH8102) OX=84588 GN=bsmB PE=1 SV=1
20	Q9EPL4	0.058	36.2	318	0.139	0.097	METL9_MOUSE Protein-L-histidine N-pros-methyltransferase OS=Mus musculus OX=10090 GN=Mettl9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03910 Adeno_PV	2.7e+02	11.7	Adenovirus minor core protein PV
2	PF08241 Methyltransf_11	4.9e-08	44.9	Methyltransferase domain
3	PF08242 Methyltransf_12	2.2e-06	39.7	Methyltransferase domain
4	PF00891 Methyltransf_2	0.16	22.8	O-methyltransferase domain
5	PF13489 Methyltransf_23	0.35	22.2	Methyltransferase domain
6	PF13649 Methyltransf_25	4e-09	48.4	Methyltransferase domain
7	PF13847 Methyltransf_31	0.13	23.5	Methyltransferase domain
8	PF05891 Methyltransf_PK	9e-91	314.8	AdoMet dependent proline di-methyltransferase
9	PF01209 Ubie_methyltran	0.24	22.3	ubiE/COQ5 methyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000021419

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000021314	0.778	Ubiquitin-related modifier 1
2	61853.ENSNLEP00000002977	0.759	Aralkylamine N-acetyltransferase
3	61853.ENSNLEP00000006913	0.695	EH domain binding protein 1-like 1
4	61853.ENSNLEP00000011943	0.695	EH domain binding protein 1
5	61853.ENSNLEP00000004139	0.646	Kelch-like family member 31
6	61853.ENSNLEP00000017833	0.646	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4
7	61853.ENSNLEP00000011961	0.638	Regulator of chromosome condensation 1
8	61853.ENSNLEP00000000645	0.637	EEF1A lysine methyltransferase 2
9	61853.ENSNLEP00000020904	0.637	U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase
10	61853.ENSNLEP00000005276	0.625	SET domain containing 4
11	61853.ENSNLEP00000020879	0.608	tRNA (guanine-N(7)-)-methyltransferase
12	61853.ENSNLEP00000002138	0.559	Carnosine N-methyltransferase 1
13	61853.ENSNLEP00000008365	0.559	Methyltransferase like 4
14	61853.ENSNLEP00000003485	0.557	Ribosomal protein L23a
15	61853.ENSNLEP00000022130	0.545	Protein arginine methyltransferase 6
16	61853.ENSNLEP00000022866	0.541	tRNA methyltransferase 12 homolog (S. cerevisiae)
17	61853.ENSNLEP00000007858	0.528	Zinc finger CCCH-type containing 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008757	1.000	S-adenosylmethionine-dependent methyltransferase activity
GO:0008276	1.000	protein methyltransferase activity
GO:0005515	0.985	protein binding
GO:0008170	0.742	N-methyltransferase activity
GO:0042054	0.687	histone methyltransferase activity
GO:0071885	0.682	N-terminal protein N-methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.997	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0043170	0.992	macromolecule metabolic process
GO:1901564	0.963	organonitrogen compound metabolic process
GO:0044260	0.927	cellular macromolecule metabolic process
GO:0018193	0.923	peptidyl-amino acid modification
GO:0032259	0.889	methylation
GO:0043414	0.830	macromolecule methylation
GO:0006479	0.794	protein methylation
GO:0031365	0.749	N-terminal protein amino acid modification
GO:0018208	0.498	peptidyl-proline modification
GO:0071840	0.355	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.997	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.
EC:2.1.1.244	0.682	protein N-terminal methyltransferase.

[back to server]